KEGG   Rattus norvegicus (rat): 25557Help
Entry
25557             CDS       T01003                                 

Gene name
Star
Definition
(RefSeq) steroidogenic acute regulatory protein
  KO
K16931  steroidogenic acute regulatory protein, mitochondrial
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04913  Ovarian steroidogenesis
rno04925  Aldosterone synthesis and secretion
rno04927  Cortisol synthesis and secretion
rno04934  Cushing syndrome
rno04979  Cholesterol metabolism
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    25557 (Star)
   04925 Aldosterone synthesis and secretion
    25557 (Star)
   04927 Cortisol synthesis and secretion
    25557 (Star)
  09154 Digestive system
   04979 Cholesterol metabolism
    25557 (Star)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    25557 (Star)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: START Polyketide_cyc
Motif
Other DBs
NCBI-GeneID: 25557
NCBI-ProteinID: NP_113746
RGD: 3770
Ensembl: ENSRNOG00000015052
UniProt: P97826
Position
16q12.4
AA seq 284 aa AA seqDB search
MLLATFKLCAGSSYRHMRNMKGLRHQAVLAIGQELNRRALGDPSPGWMGQVRRRSSLLGS
QLEATLYSDQELSYIQQGEEAMQKALGILNNQEGWKKESQQENGDEVLSKVVPGVGKVFR
LEVLLDQPMDRLYEELVDRMEAMGEWNPNVKEIKVLKKIGKDTVITHELAAAAAGNLVGP
RDFVSVRCTKRRGSTCVLAGMATHFGEMPEQSGVIRAEHGPTCMVLHPLAGSPSKTKLTW
LLSIDLKGWLPKTIINQVLSQTQIEFASHLRKRLESSPASEAQC
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgttactagctacattcaagctgtgtgctgggagctcctacagacatatgcggaacatg
aaaggactgaggcatcaagctgtgctagccattggccaagagctgaaccggagagcccta
ggggaccccagtcctgggtggatgggtcaggtccggcgtcggagctctctacttggttct
caactggaagcaacactctacagtgaccaggagctgtcctacatccagcaaggagaggaa
gctatgcaaaaggccttgggcatactcaacaaccaggaaggctggaagaaggaaagccag
caggagaatggagatgaagtgctaagtaaggtggtgccaggtgtgggcaaggtgttccga
ctggaggtgctgctagaccagcccatggacagactctatgaagaactggtggaccgcatg
gaggccatgggagagtggaacccaaatgtcaaggaaatcaaggtcctgaagaagattgga
aaagacacagtcatcacccatgagctggctgcagcagcagcaggcaacctggtggggccc
cgagacttcgtaagcgtacgctgtaccaagcgtagaggttccacctgtgtgctggcaggc
atggccacacactttggggagatgcctgagcaaagcggtgtcatcagagctgaacacggt
cccacctgcatggtgcttcatccactggctggaagtccctcaaagaccaaactcacgtgg
ctgctcagtattgacctcaaggggtggctgccaaagaccatcatcaaccaagtcttatca
cagacccagatagagttcgccagccacttgcgcaagcgcttggagtccagccctgcctct
gaggcccagtgttaa

DBGET integrated database retrieval system