KEGG   Rattus norvegicus (rat): 25558
Entry
25558             CDS       T01003                                 

Gene name
Stxbp1
Definition
(RefSeq) syntaxin-binding protein 1
  KO
K15292  syntaxin-binding protein 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04721  Synaptic vesicle cycle
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09156 Nervous system
   04721 Synaptic vesicle cycle
    25558 (Stxbp1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    25558 (Stxbp1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    25558 (Stxbp1)
Membrane trafficking [BR:rno04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    25558 (Stxbp1)
 SNARE
  SNARE associated proteins
   Syntaxin-binding proteins
    25558 (Stxbp1)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   25558 (Stxbp1)
SSDB
Motif
Pfam: Sec1 YlbD_coat FRB_dom
Other DBs
NCBI-GeneID: 25558
NCBI-ProteinID: NP_037170
RGD: 3785
Ensembl: ENSRNOG00000015420
UniProt: P61765
Structure
PDB: 
4JEH 3C98 4JEU 3PUJ

Position
3
AA seq 594 aa
MAPIGLKAVVGEKIMHDVIKKVKKKGEWKVLVVDQLSMRMLSSCCKMTDIMTEGITIVED
INKRREPLPSLEAVYLITPSEKSVHSLISDFKDPPTAKYRAAHVFFTDSCPDALFNELVK
SRAAKVIKTLTEINIAFLPYESQVYSLDSADSFQSFYSPHKAQMKNPILERLAEQIATLC
ATLKEYPAVRYRGEYKDNALLAQLIQDKLDAYKADDPTMGEGPDKARSQLLILDRGFDPS
SPVLHELTFQAMSYDLLPIENDVYKYETSGIGEARVKEVLLDEDDDLWIALRHKHIAEVS
QEVTRSLKDFSSSKRMNTGEKTTMRDLSQMLKKMPQYQKELSKYSTHLHLAEDCMKHYQG
TVDKLCRVEQDLAMGTDAEGEKIKDPMRAIVPILLDANVSTYDKIRIILLYIFLKNGITE
ENLNKLIQHAQIPPEDSEIITNMAHLGVPIVTDSTLRRRSKPERKERISEQTYQLSRWTP
IIKDIMEDTIEDKLDTKHYPYISTRSSASFSTTAVSARYGHWHKNKAPGEYRSGPRLIIF
ILGGVSLNEMRCAYEVTQANGKWEVLIGSTHILTPQKLLDTLKKLNKTDEEISS
NT seq 1785 nt   +upstreamnt  +downstreamnt
atggcccccattggcctcaaggcggtggtcggagagaagatcatgcatgatgttatcaag
aaggtgaagaagaagggcgagtggaaggtgctggtggtggaccagttaagcatgaggatg
ctgtcttcctgctgcaagatgacagacatcatgaccgaggggatcacaattgtggaggat
atcaacaagcgccgagagccgctccccagcctagaggccgtgtacctcatcaccccgtct
gagaagtctgtccactctctcatcagtgattttaaggacccgccgactgctaaatatcgg
gccgcacatgtgttcttcacagactcatgtccagatgccctgtttaacgagctggtaaaa
tctcgagcagccaaagtcatcaagacgctgacggaaatcaacattgcgtttctcccctat
gagtcccaggtgtattccctggactccgctgactctttccaaagtttctacagccctcac
aaggcacagatgaagaatcccatactggaacgcctggcagagcaaatcgccaccctgtgt
gccaccctgaaggagtacccggctgtgcggtatcggggggagtacaaggacaatgccttg
ctggctcagctgatccaggacaagctggacgcttataaagctgatgacccgacaatgggg
gagggtcccgacaaggcacggtcccagctcctgatcctggatcgtggctttgaccccagc
tcccctgtgcttcatgaactgacgtttcaggctatgagttacgacctgctgcctattgaa
aatgatgtttacaagtatgagaccagcggcattggagaggcgagggtgaaggaggtgctc
ctggatgaggacgatgacctgtggattgcactgcgacacaagcacatcgcagaggtgtcc
caggaagtgacccggtctctgaaggacttttcctctagcaagaggatgaatactggagag
aagaccaccatgcgggacctgtcccagatgctgaagaaaatgccccagtaccagaaggag
ctcagcaagtattcgactcacctgcaccttgctgaagactgtatgaagcattaccaaggc
accgtagacaaactctgccgcgtggagcaggacctggcgatgggcacagatgctgagggg
gaaaaaatcaaggaccccatgagagccattgtccccatcctgctggatgcaaatgtcagc
acttatgacaaaattcgcatcatccttctctacatcttcctgaagaacggtatcactgaa
gaaaacctaaacaaactcatccagcacgcccagatccccccagaagacagtgagatcatc
accaacatggctcacctcggggtgcccatcgtcacggattccacactacgccgcagaagc
aagccggagcggaaggagcgcatcagtgagcagacctaccagctctcacgatggaccccg
atcattaaagacattatggaggacaccattgaagacaaactggatacaaagcactaccca
tacatctctacccgctcttccgcatccttcagcaccactgctgtgagtgcccgctatgga
cattggcacaagaataaggcccccggggagtaccgcagcggcccccgcctcattattttc
atccttgggggcgtgagcctgaatgagatgcgctgtgcctacgaagtgacgcaggccaac
ggcaagtgggaagtgctcataggatccacgcacattctcaccccacagaaactgctggac
acgctgaagaagctgaataaaacagacgaagaaataagcagttaa

DBGET integrated database retrieval system