KEGG   Rattus norvegicus (rat): 25559Help
Entry
25559             CDS       T01003                                 

Gene name
Abcc8, Sur, Sur1
Definition
(RefSeq) ATP binding cassette subfamily C member 8
  KO
K05032  ATP-binding cassette subfamily C (CFTR/MRP) member 8
Organism
rno  Rattus norvegicus (rat)
Pathway
rno02010  ABC transporters
rno04911  Insulin secretion
rno04930  Type II diabetes mellitus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    25559 (Abcc8)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    25559 (Abcc8)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    25559 (Abcc8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    25559 (Abcc8)
Transporters [BR:rno02000]
 ABC Transporters, Eukaryotic Type
  ABCC (CFTR/MRP) subfamily
   ABCC8, 9 subgroups
    25559 (Abcc8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ABC_membrane ABC_tran SMC_N AAA_29 AAA_25 ATPase RsgA_GTPase ABC_ATPase Zeta_toxin
Motif
Other DBs
NCBI-GeneID: 25559
NCBI-ProteinID: NP_037171
RGD: 3786
Ensembl: ENSRNOG00000021130
UniProt: Q09429
Position
1q22
AA seq 1582 aa AA seqDB search
MPLAFCGTENHSAAYRVDQGVLNNGCFVDALNVVPHVFLLFITFPILFIGWGSQSSKVHI
HHSTWLHFPGHNLRWILTFILLFVLVCEIAEGILSDGVTESRHLHLYMPAGMAFMAAITS
VVYYHNIETSNFPKLLIALLIYWTLAFITKTIKFVKFYDHAIGFSQLRFCLTGLLVILYG
MLLLVEVNVIRVRRYVFFKTPREVKPPEDLQDLGVRFLQPFVNLLSKGTYWWMNAFIKTA
HKKPIDLRAIGKLPIAMRALTNYQRLCLAFDAQARKDTQSQQGARAIWRALCHAFGRRLV
LSSTFRILADLLGFAGPLCIFGIVDHLGKENHVFQPKTQFLGVYFVSSQEFLGNAYVLAV
LLFLALLLQRTFLQASYYVAIETGINLRGAIQTKIYNKIMHLSTSNLSMGEMTAGQICNL
VAIDTNQLMWFFFLCPNLWAMPVQIIVGVILLYYILGVSALIGAAVIILLAPVQYFVATK
LSQAQRSTLEYSNERLKQTNEMLRGIKLLKLYAWENIFCSRVEKTRRKEMTSLRAFAVYT
SISIFMNTAIPIAAVLITFVGHVSFFKESDFSPSVAFASLSLFHILVTPLFLLSSVVRST
VKALVSVQKLSEFLSSAEIREEQCAPREPAPQGQAGKYQAVPLKVVNRKRPAREEVRDLL
GPLQRLTPSTDGDADNFCVQIIGGFFTWTPDGIPTLSNITIRIPRGQLTMIVGQVGCGKS
SLLLATLGEMQKVSGAVFWNSSLPDSEGEDPSNPERETAADSDARSRGPVAYASQKPWLL
NATVEENITFESPFNKQRYKMVIEACSLQPDIDILPHGDQTQIGERGINLSGGQRQRISV
ARALYQHTNVVFLDDPFSALDVHLSDHLMQAGILELLRDDKRTVVLVTHKLQYLPHADWI
IAMKDGTIQREGTLKDFQRSECQLFEHWKTLMNRQDQELEKETVMERKAPEPSQGLPRAM
SSRDGLLLDEDEEEEEAAESEEDDNLSSVLHQRAKIPWRACTKYLSSAGILLLSLLVFSQ
LLKHMVLVAIDYWLAKWTDSALVLSPAARNCSLSQECALDQSVYAMVFTVLCSLGIALCL
VTSVTVEWTGLKVAKRLHRSLLNRIILAPMRFFETTPLGSILNRFSSDCNTIDQHIPSTL
ECLSRSTLLCVSALAVISYVTPVFLVALLPLAVVCYFIQKYFRVASRDLQQLDDTTQLPL
LSHFAETVEGLTTIRAFRYEARFQQKLLEYTDSNNIASLFLTAANRWLEVRMEYIGACVV
LIAAATSISNSLHRELSAGLVGLGLTYALMVSNYLNWMVRNLADMEIQLGAVKRIHTLLK
TEAESYEGLLAPSLIPKNWPDQGKIQIQNLSVRYDSSLKPVLKHVNALISPGQKIGICGR
TGSGKSSFSLAFFRMVDMFEGRIIIDGIDIAKLPLHTLRSRLSIILQDPVLFSGTIRFNL
DPEKKCSDSTLWEALEIAQLKLVVKALPGGLDAIITEGGENFSQGQRQLFCLARAFVRKT
SIFIMDEATASIDMATENILQKVVMTAFADRTVVTIAHRVHTILSADLVMVLKRGAILEF
DKPEKLLSQKDSVFASFVRADK
NT seq 4749 nt NT seq  +upstreamnt  +downstreamnt
atgcctttggccttctgcggcaccgagaaccactcggccgcctaccgggtggaccaaggc
gtcctcaacaacggctgcttcgtggacgcgctcaatgtggtgccacatgtctttctgctc
ttcatcaccttccccatcctcttcatcggatggggcagccagagctccaaggtgcacatt
caccacagcacctggctccatttcccggggcacaacctgcgctggatcctgaccttcata
ctgctcttcgtcctcgtgtgtgagatcgctgagggtatcctgtctgacggggtgacagaa
tcccgccacctccacttatacatgccagctgggatggcattcatggctgccatcacctct
gtggtctactaccataacattgagacctctaactttcccaagctgctgattgctctgctc
atctactggaccctggccttcatcacgaagaccatcaagttcgtcaagttctacgaccac
gccattggcttctctcagctgcgcttctgcctcacggggcttctggtgatcctctacggg
atgctgctgcttgtggaggtcaatgtcatccgggtgaggagatacgtcttcttcaagaca
ccaagggaagtaaagccccccgaggacctacaggacctgggtgtgcgctttctgcagccc
ttcgttaacctgctatcaaaggggacctactggtggatgaatgccttcatcaagactgct
cacaagaagcccatcgacctgcgggccatcgggaagctgcccattgccatgagagccctc
accaactaccagcgactctgcttggccttcgatgcccaggcgcggaaggacacacagagc
cagcagggtgcccgggccatctggagggctctctgtcatgcctttgggagacggctggtc
ctcagcagcacattccgtatcctggccgacctcctgggctttgctgggccactctgcatc
ttcgggatcgtggaccacctcgggaaggagaaccacgtcttccagcccaagacacagttt
cttggagtttactttgtctcatcccaagagttcctcggcaatgcctatgtcttggctgtt
cttctgttccttgccctcctgctgcaaaggacctttctacaagcctcgtactacgttgcc
attgaaactgggatcaacctgagaggagcaatccagaccaagatttacaataagatcatg
cacttgtctacttccaacctgtccatgggggaaatgactgctgggcagatctgcaacctg
gtggccatcgacaccaaccagctcatgtggtttttcttcttatgcccaaacctctgggct
atgccggtacagatcattgtgggcgtgatcctcctctactacatccttggggtcagcgcc
ttgattggagcggctgtcatcattctgctggctcctgtacagtactttgtggccaccaag
ctgtcccaggcacagcggagcaccctggaatattccaatgagaggctgaagcagaccaat
gagatgctccggggcatcaagttgctcaagctctatgcgtgggagaacatcttctgctcc
agggtggagaagacacgcaggaaggaaatgaccagcctcagggccttcgctgtctacacc
tccatctccatcttcatgaacacagctatccccatcgctgctgtcctcatcaccttcgtg
ggccacgtcagcttcttcaaagagtcggacttctcgccctcggtggcctttgcctctctc
tctctcttccacatcctggtcacaccgctgttcctgctgtctagtgtggttcggtccact
gtcaaggccctggtgagcgtgcaaaagctgagtgagttcctgtccagtgcagagatccgt
gaggaacagtgtgccccccgagagcccgcaccccaaggccaagcgggcaagtaccaggcg
gtgcccctcaaggtcgtaaaccgcaagcgcccagcccgagaagaagtccgggacctcttg
ggcccactgcagaggctgactcccagcacggatggagacgctgacaacttctgtgtccag
atcatcggaggcttcttcacctggacccctgatggaatccccaccctgtccaacatcacc
atccgtatcccccgaggtcagctgaccatgatcgtggggcaggtgggctgtggcaagtcc
tcgctccttctggccaccctgggggagatgcagaaggtctctggagctgtcttctggaac
agcagccttccagacagcgagggagaagaccccagcaacccagagcgggagacagcggcc
gattcggatgccaggagcagaggccctgtggcctacgcatctcagaaaccatggctgcta
aatgccactgtggaggagaacatcaccttcgagagtcccttcaataagcaacggtacaag
atggtcatcgaagcctgctccctgcagccagacatagacatcctgccccatggagaccag
actcagattggggaacggggcatcaacttgtctggtggtcagcgtcagcgaatcagtgta
gcccgagccctctaccagcacaccaatgttgtctttttggatgaccctttctcggctctg
gatgtccatctgagtgaccacctaatgcaggctggcatcctcgagctgctccgggatgac
aagaggacagtggtcttggtgacccacaagctacagtacctgcctcatgctgactggatc
attgctatgaaggatggcaccattcagagggaggggacactcaaggacttccagaggtct
gagtgccagctctttgagcattggaagaccctcatgaaccggcaggaccaagagctggag
aaggagacagtcatggagagaaaagccccagagccatctcagggcctgccccgtgccatg
tcctcaagagatggccttctgctggatgaggatgaggaggaagaggaggcagccgagagc
gaggaagatgacaacttatcctctgtgctgcatcagcgagccaagatcccatggcgagcc
tgcaccaagtatttgtcctctgctggcatcctgctcctgtccctgcttgtcttctcccag
ctgctcaagcacatggtcttggtggccattgactactggctggccaagtggacggacagt
gccctggtcctgagccccgccgccaggaactgctccctcagccaggaatgtgccctggac
caatctgtctatgccatggtattcaccgtgctctgcagcctgggtatcgcgctgtgcctt
gtcacctctgtcactgtggagtggacgggactgaaggtggccaagaggctgcatcgcagc
ctgctcaaccgtatcatcctggctcccatgaggttctttgagaccacgcccctggggagt
atcctgaacagattttcatctgactgtaacaccattgaccagcatatcccgtccacgctg
gagtgcctgagcagatccaccttactctgtgtctccgccctggctgtcatctcctacgtc
acgcctgtgttcctagtggccctcttacccctcgccgtcgtgtgctacttcatccagaag
tacttccgagtggcgtccagggacctgcagcagctggacgacacaacacagctccctctg
ctctcacactttgctgaaactgtggaaggactcaccaccatccgtgccttcaggtacgag
gcccggttccagcagaagctcctagagtacaccgactccaacaacattgcctctctcttc
ctcacagcagccaacaggtggctggaagtccgcatggagtacatcggagcatgcgtggta
ctcatcgccgctgccacctccatctccaactccctacacagggagctctcagccggccta
gtaggcctgggcctcacctatgccttgatggtctccaactacctcaactggatggtgagg
aacctggcagacatggagatccaactgggagctgtgaagcgtatccacacactcctgaaa
actgaggcagagagctatgaggggctcctggcaccatcgctgatccccaagaactggcca
gaccaagggaagatccaaattcaaaacctgagtgtacgctatgacagctccctgaagccc
gtgctgaagcacgtcaacgccctcatctccccaggacagaagattgggatctgcggccgc
acaggcagtggaaaatcctccttctctctcgcctttttccgaatggtggatatgtttgaa
gggcgtatcatcatcgatggcattgacatcgccaagctgccgctgcacacgctccgctca
cgcctgtctatcatcctacaggaccctgttctcttcagtggtaccatcagattcaacctg
gacccagagaagaaatgctcagacagcacgctgtgggaggctctggagatcgctcagctg
aagctggtggtgaaggccctgccaggaggcctggatgccatcatcacggaaggaggggag
aattttagccagggccagaggcagctgttctgcctggcccgggcctttgtgaggaagacc
agcatcttcatcatggatgaagcaactgcctccatcgacatggctacggaaaatatcctc
cagaaggtggtgatgacagccttcgcagaccgcaccgtggtcaccatcgcgcaccgcgtg
cacaccatcctgagtgcagacctagtgatggtcctgaagaggggcgcgatcctggagttc
gacaagccggaaaagcttctcagccagaaggacagcgtctttgcctcctttgtccgcgcg
gacaaatga

DBGET integrated database retrieval system