KEGG   Rattus norvegicus (rat): 25560
Entry
25560             CDS       T01003                                 

Gene name
Abcc9, Sur2
Definition
(RefSeq) ATP binding cassette subfamily C member 9
  KO
K05033  ATP-binding cassette subfamily C (CFTR/MRP) member 9
Organism
rno  Rattus norvegicus (rat)
Pathway
rno02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    25560 (Abcc9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    25560 (Abcc9)
   04147 Exosome [BR:rno04147]
    25560 (Abcc9)
Transporters [BR:rno02000]
 ABC transporters, eukaryotic type
  ABCC (CFTR/MRP) subfamily
   ABCC8, 9 subgroups
    25560 (Abcc9)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   25560 (Abcc9)
SSDB
Motif
Pfam: ABC_membrane ABC_tran SMC_N AAA_21 RsgA_GTPase AAA_29 MTABC_N AAA_25 Zeta_toxin AAA_16 AAA_24 ATPase_2 FAM177
Other DBs
NCBI-GeneID: 25560
NCBI-ProteinID: NP_037172
RGD: 3787
Ensembl: ENSRNOG00000036960
UniProt: Q63563
Position
4q44
AA seq 1545 aa
MSLSFCGNNISSYNIYHGVLQNPCFVDALNLVPHVFLLFITFPILFIGWGSQSSKVQIHH
NTWLHFPGHNLRWILTFALLFVHVCEIAEGIVSDSQRASRHLHLFMPAVMGFVATTTSIV
YYHNIETSNFPKLLLALFLYWVMAFITKTIKLVKYWQLGWGMSDLRFCITGVMVILNGLL
MAVEINVIRVRRYVFFMNPQKVKPPEDLQDLGVRFLQPFVNLLSKATYWWMNTLIISAHR
KPIDLKAIGKLPIAMRAVTNYVCLKEAYEEQKKKAADHPNRTPSIWLAMYRAFGRPILLS
STFRYLADLLGFAGPLCISGIVQRVNEPKNNTTRFSETLSSKEFLENAHVLAVLLFLALI
LQRTFLQASYYVTIETGINLRGALLAMIYNKILRLSTSNLSMGEMTLGQINNLVAIETNQ
LMWFLFLCPNLWAMPVQIIMGVILLYNLLGSSALVGAAVIVLLAPIQYFIATKLAEAQKS
TLDYSTERLKKTNEILKGIKLLKLYAWEHIFCKSVEETRMKELSSLKTFALYTSLSIFMN
AAIPIAAVLATFVTHAYASGNNLKPAEAFASLSLFHILVTPLFLLSTVVRFAVKAIISVQ
KLNEFLLSDEIGEDSWRTGEGTLPFESCKKHTGVQSKPINRKQPGRYHLDNYEQARRLRP
AETEDVAIKVTNGYFSWGSGLATLSNIDIRIPTGQLTMIVGQVGCGKSSLLLAILGEMQT
LEGKVYWNNVNESEPSFEATRSRSRYSVAYAAQKPWLLNATVEENITFGSSFNRQRYKAV
TDACSLQPDIDLLPFGDQTEIGERGINLSGGQRQRICVARALYQNTNIVFLDDPFSALDI
HLSDHLMQEGILKFLQDDKRTVVLVTHKLQYLTHADWIIAMKDGSVLREGTLKDIQTKDV
ELYEHWKTLMNRQDQELEKDMEADQTTLERKTLRRAMYSREAKAQMEDEDEEEEEEEDED
DNMSTVMRLRTKMPWKTCWWYLTSGGFFLLFLMIFSKLLKHSVIVAIDYWLATWTSEYSI
NDPGKADQTFYVAGFSILCGAGIFLCLVTSLTVEWMGLTAAKNLHHNLLNKIILGPIRFF
DTTPLGLILNRFSADTNIIDQHIPPTLESLTRSTLLCLSAIGMISYATPVFLIALAPLGV
AFYFIQKYFRVASKDLQELDDSTQLPLLCHFSETAEGLTTIRAFRHETRFKQRMLELTDT
NNIAYLFLSAANRWLEVRTDYLGACIVLTASIASISGSSNSGLVGLGLLYALTITNYLNW
VVRNLADLEVQMGAVKKVNSFLTMESENYEGTMDPSQVPEHWPQEGEIKIHDLCVRYENN
LKPVLKHVKAYIKPGQKVGICGRTGSGKSSLSLAFFRMVDIFDGKIVIDGIDISKLPLHT
LRSRLSIILQDPILFSGSIRFNLDPECKCTDDRLWEALEIAQLKNMVKSLPGGLDATVTE
GGENFSVGQRQLFCLARAFVRKSSILIMDEATASIDMATENILQKVVMTAFADRTVVTIA
HRVHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM
NT seq 4638 nt   +upstreamnt  +downstreamnt
atgagcctttccttctgtggtaacaacatctcctcctacaacatctaccatggtgttctc
caaaacccctgctttgtggacgcactcaacctggtccctcacgtcttcctgctgtttatc
acctttccgatcctgttcattggatgggggagccaaagctcaaaagtgcaaattcatcac
aacacatggcttcattttcctggacacaacctgagatggattctgacgtttgcactcctg
tttgtgcatgtctgcgagatagcagaaggcattgtttcagactcgcaacgggcgtccagg
catctccaccttttcatgccggctgtgatgggatttgtcgccaccaccacatccattgtg
tattaccacaacattgaaacatcaaacttccctaaattacttttagctttattcctgtac
tgggtcatggccttcattacaaagacaataaagttggtcaaatactggcagttggggtgg
ggaatgtcagacctgcgcttctgcatcacgggagtgatggtcatcttgaatggactgctg
atggctgtggagatcaatgtcatccgggtccgaagatatgttttcttcatgaatcctcag
aaagtgaagcctccagaggacctccaggacctgggcgtgaggttcctccagccgtttgtg
aatttgctgtccaaagctacttactggtggatgaacacgcttatcatatcagctcacagg
aaacctattgatctgaaggcgatcggaaagttgccgatagcaatgagggcggtgacgaat
tatgtttgcttgaaggaggcctacgaagagcagaagaaaaaggctgcggatcatccgaat
cggactccctccatatggctggccatgtacagggcttttgggagaccgatcctgctgagc
agcacgttccgctacttggctgacttgctgggctttgccggccctctttgtatttccgga
atcgtccagcgtgtgaatgaaccgaagaataacacgacgagattttcagagacactctca
tcaaaggagtttctggaaaatgcccatgtgctggctgtcctgctcttcctggccctcatc
ctgcaaagaacatttttgcaggcttcgtactatgtgaccatagagaccggcatcaacctg
cgtggggctctgctggctatgatctacaacaaaatccttcgactgtctacttctaaccta
tccatgggcgagatgaccctgggacagatcaacaacttggttgccatagaaaccaatcag
ctcatgtggttcttgttcctgtgtcccaatctgtgggccatgcccgttcagatcataatg
ggggtgatcctgctctataatctgcttgggtcaagcgcactggtaggcgcggcggtcatc
gtgctcctcgcaccgattcagtacttcatcgccacgaagctggcggaggctcagaagagc
actctggattattccaccgagaggctgaagaagacaaacgagatactgaaaggcatcaag
ctccttaagctgtatgcctgggagcacattttctgcaagagcgtggaagagactagaatg
aaggagctctccagcctcaaaaccttcgcgctctacacgtcgctttccatcttcatgaac
gcagccattcccatcgcagccgttcttgcaacatttgtgacccatgcctatgccagtggc
aacaacctgaaacccgcagaggcctttgcctctctgtctctcttccacatcctcgtcaca
ccgctcttcctgctgtccacggtggtcagattcgcagtgaaagccatcatcagcgttcag
aagctgaatgagtttctcttgagcgatgagattggcgaggacagctggaggactggggag
gggacgctgccttttgagtcctgtaagaagcacaccggagtgcaatcaaaaccgataaac
aggaagcagcctggaaggtaccacctggacaactacgagcaggcgcggcgtcttcggcct
gctgagactgaagatgttgccataaaggtgacgaacggatacttctcatggggcagtggt
ttagccacattatccaatattgacattcgaattccaacaggtcagctaaccatgattgtg
ggtcaggtgggttgtggcaaatcgtctctcctccttgccatccttggtgagatgcagacc
ctggaaggaaaagtttactggaacaatgtaaatgaatctgagccttcttttgaagcaacc
cgaagcagaagcaggtactctgtggcttatgctgcccagaagccttggctcctcaatgct
acggtcgaggaaaacatcacttttggaagttctttcaacagacagaggtacaaggctgtc
accgatgcctgctctctgcagccagacattgatttgttaccctttggagaccaaactgaa
attggagagaggggtatcaacctgagtgggggtcagaggcagagaatctgcgtggcccgg
gcactctaccagaacaccaatattgtcttcttggacgatccattctccgctctggacatc
cacctgagcgaccacttgatgcaggaagggatcctgaagtttctccaggacgacaagagg
acggtcgtccttgtgactcacaaactacagtacctgacgcacgcggactggatcatagcc
atgaaggatgggagtgtgttaagggaagggactttgaaagacatccagaccaaagacgtg
gagctctatgaacactggaaaaccctcatgaatcggcaagatcaggaattagaaaaggac
atggaagccgaccaaacaacgctggagaggaagactctccgaagagctatgtactcaagg
gaggccaaagcacagatggaggatgaagatgaagaggaggaggaggaggaagatgaggac
gacaacatgtcaactgtaatgaggctcaggacgaagatgccctggaagacctgttggtgg
tacctcacttcaggagggtttttcctgctcttcctcatgatcttctctaagcttttgaag
cactctgtgatcgtggccatcgactactggctagctacgtggacctccgagtacagtata
aacgacccagggaaagctgaccagaccttctatgtggctgggttcagcatcctctgtgga
gcgggcattttcctttgcctcgtcacctccctcactgtagaatggatgggtctcaccgcc
gccaagaacctccaccacaatctcctcaataagataattctgggcccaataaggttcttt
gataccacgcccctgggactgatcctcaatcggttttctgctgataccaacatcatcgac
caacatatccctccgaccttggagtcgctgacccgctctaccctgctctgcctgtcggct
attgggatgatctcctatgctacacccgtgtttctcatcgctcttgcgcccctgggcgtc
gccttttatttcatccagaaatacttccgggttgcctctaaggatctccaggaactcgat
gacagcacccagctccccctgctttgtcacttctcagaaacagctgaagggcttaccact
atccgggccttcaggcatgaaaccagattcaagcaacgcatgctggagctgacagacaca
aacaacattgcctacttatttctctccgcagccaacagatggctggaggtcaggacggac
tacctgggagcttgcattgttctgacggcctccattgcatccatcagtggctcttccaac
tctggactagtgggcttgggccttctgtatgccctcacgataaccaattacctgaattgg
gttgtaaggaacttggccgacctcgaagtccagatgggcgcagtgaagaaagtgaacagt
ttcttaactatggagtctgagaactatgaaggcaccatggatccttctcaagtcccagag
cattggccacaggaaggtgagatcaagattcacgatctatgcgtcagatatgaaaataac
ctgaagcccgttctgaaacatgtcaaggcttacatcaagcctgggcagaaggtgggcatc
tgtggtcgcaccggtagtgggaagtcctctctatctctggctttcttcagaatggtcgac
atatttgatggaaagatagtcattgatggaatagacatttccaagctgcccttgcacacg
ctccgctctagactgtccatcattctccaggacccaatcctgttcagcggctctatcaga
tttaacttggatcctgaatgcaagtgcacagacgacaggctctgggaggctctggaaatt
gctcagttgaagaatatggtcaaatctctgccaggaggcctagacgccactgtcaccgaa
ggtggtgagaacttcagcgttggacagagacagctgttctgcctggccagggcctttgtt
cgaaagagcagcatactcattatggatgaggccacggcctccatcgacatggccacggaa
aacattttgcagaaagtagtcatgacagcctttgcggatcgcacggttgtaaccatagct
catcgggttcacaccattctgactgctgacctggtcattgtgatgaagagaggaaacatt
ttggaatacgacaccccggaaagcctcttggcccaggaggatggagtgttcgcctcgttc
gttcgtgcggacatgtga

DBGET integrated database retrieval system