KEGG   Rattus norvegicus (rat): 25562Help
Entry
25562             CDS       T01003                                 

Gene name
Eloa, El, Tceb3
Definition
(RefSeq) elongin A
  KO
K15076  elongin-A
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:rno03400]
    25562 (Eloa)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     25562 (Eloa)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Elongin_A Med26
Motif
Other DBs
NCBI-GeneID: 25562
NCBI-ProteinID: NP_058799
RGD: 3827
Ensembl: ENSRNOG00000010902
UniProt: Q66HK4
Position
5q36
AA seq 773 aa AA seqDB search
MAAESALQVVEKLQARLAANPDPKKLLKYLKKLSVLPITVDILVETGVGKTVNSFRKHEQ
VGNFARDLVAQWKKLVPVERNNEAEDQDFEKSNSRKRPRDVPQQEEEAEGNYQESWQASG
SQPYSPEHRQKKHRKLPELERPHKVAHGHERRDERKRCHKVSPPYSSDPESSDYGHVQSP
PPSSPHQMYTDLSRSPEMDQEPIVSHPKPGKVHSNTFQDRLGVSHLGEHQGKGAVSQNKP
HKSSHKEKRPVDARGDEKSSVMGREKSHKASSKEESRRLLSEDSAKEKLPSSVVKKEKDR
EGNSLKKKLSPALDVASDNHFKKPKHKDSEKIKSDKNKQSVDSVDSGRGTGDPLPRAKDK
VPNNLKAQEGKVRTNSDRKSPGSLPKVEEMDMDDEFEQPTMSFESYLSYDQPRKKKKKVV
KTSGTALGEKGLKKKDSKSTSKNLNSAQKLPKVNENKSDKLQPAGAEPTRPRKVPTDVLP
ALPDIPLPAIQTNYRPLPSLELISSFQPKRKAFSSPQEEEEAGFTGRRMNSKMQVYSGSK
CAYLPKMMTLHQQCIRVLKNNIDSIFEVGGVPYSVLEPVLERCTPDQLYRIEECNHVLIE
ETDQLWKVHCHRDFKEERPEEYESWREMYLRLQDAREQRLRLLTNNIRSAHANKPKGRQA
KMAFVNSVAKPPRDVRRRQEKFGTGGAAVPEKVRIKPAPYTTGSSHVPASNSSSSFHSSP
EELAYEGPSTSSAHLAPVASSSVSYDPRKPAVKKIAPMMAKTIKAFKNRFSRR
NT seq 2322 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggagtcggcgctccaagttgtggagaagctgcaggcgcgcctggctgcgaac
ccggaccccaagaagctattgaaatatttgaagaaactttccgtcttacctattacagta
gacattcttgtggagactggggtggggaaaacagtgaacagctttcggaaacatgagcaa
gtgggaaactttgccagagacctggttgcccagtggaagaagctggttccagtagaacga
aacaatgaggctgaggatcaggattttgagaagagcaattcccgcaagcgtccccgagat
gttccccagcaggaggaggaagcggaggggaactaccaggaaagctggcaagcctcaggc
agccagccctacagccctgagcacagacagaaaaagcacagaaaacttcctgagcttgaa
aggcctcacaaagtggctcatggtcacgagaggagagatgaaaggaagaggtgtcacaaa
gtgtcaccaccatattcttcagaccccgagtcgtctgactatggtcatgttcaatctcct
ccaccttcaagtccccatcaaatgtatacagacctctctaggtccccagagatggaccag
gaacccatcgtctcacacccgaagcctgggaaagtccacagtaatacctttcaggacaga
ctaggggttagtcacctgggtgagcaccaagggaaaggggctgttagccaaaacaagcca
cacaaatcttcccacaaggagaaacgccctgtggatgccaggggggatgagaagagctct
gtcatgggcagagagaagtcacacaaagcctcttccaaagaggagagccgaaggctactc
tcagaggacagtgccaaggagaagctgccctccagtgttgtcaagaaagagaaggacaga
gaaggcaacagcctcaagaagaagttgtcacctgccttagatgttgcttcagacaaccac
tttaaaaagcccaaacacaaggactccgagaaaatcaagtctgacaaaaacaagcagagt
gtagatagcgtggactcaggacgagggacaggagacccattacccagagccaaggataaa
gttcccaacaacctgaaggctcaggaggggaaagtaagaactaactcggatcgaaagtca
ccaggctcactccctaaagtagaagagatggacatggatgatgagtttgagcagcccacc
atgtcctttgagtcatacctcagctatgaccagccccgcaagaaaaagaagaaggttgtg
aaaacttccggtacagcacttggagaaaaaggacttaaaaagaaggactctaaaagcact
agtaaaaacttgaactcggctcagaaattacccaaggtgaatgaaaacaagtcagacaag
ttgcagccagctggagccgaacccacgaggcctagaaaggtccctactgatgtgctgcca
gcattgccagacatccccttgcccgccatacaaaccaactatcgtccccttccctccctc
gagttgatctcctcctttcagccaaagcgaaaagctttctcttcaccccaggaagaagaa
gaagctgggttcacaggacgcagaatgaattctaagatgcaggtgtattcaggttccaag
tgtgcctatctccccaaaatgatgaccttgcaccagcagtgtatccgggtgcttaagaat
aatattgactccatctttgaagtgggaggagtcccctattctgttcttgaacctgtcttg
gagaggtgcacacccgatcagctctaccgaatagaggaatgcaatcatgtattaattgag
gaaacagatcagttgtggaaagttcactgtcaccgggactttaaggaagaaagaccagaa
gagtatgagtcttggagggagatgtacctgaggcttcaggacgcccgagagcagcggctg
cgcctgctcacaaacaacatccggtctgcacatgccaataagccaaaaggacgacaagca
aagatggcctttgtgaactctgtggccaagccaccgagagatgttcgacggaggcaggag
aagtttggaaccgggggagcagctgtccctgagaaagtcaggattaagccagcaccatat
acaacaggaagcagccatgttcctgccagcaacagcagcagcagcttccactcaagtcct
gaggagctggcctacgaagggcccagtaccagcagtgcccacttagctcctgtggccagc
agctctgtttcctatgatcccaggaaaccagctgtgaagaaaattgccccgatgatggcc
aagaccattaaagcattcaagaacagattttcccgacgataa

DBGET integrated database retrieval system