KEGG   Rattus norvegicus (rat): 25570
Entry
25570             CDS       T01003                                 

Gene name
Trhr
Definition
(RefSeq) thyrotropin-releasing hormone receptor
  KO
K04282  thyrotropin-releasing hormone receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04020  Calcium signaling pathway
rno04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    25570 (Trhr)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    25570 (Trhr)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    25570 (Trhr)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Peptide
   Thyrotropin-releasing hormone (TRH)
    25570 (Trhr)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7TM_GPCR_Srw
Other DBs
NCBI-GeneID: 25570
NCBI-ProteinID: NP_037179
RGD: 3904
Ensembl: ENSRNOG00000005048
UniProt: Q01717
Position
7
AA seq 412 aa
MENETVSELNQTELPPQVAVALEYQVVTILLVVVICGLGIVGNIMVVLVVMRTKHMRTAT
NCYLVSLAVADLMVLVAAGLPNITDSIYGSWVYGYVGCLCITYLQYLGINASSCSITAFT
IERYIAICHPIKAQFLCTFSRAKKIIIFVWAFTSIYCMLWFFLLDLNISTYKDAIVISCG
YKISRNYYSPIYLMDFGVFYVMPMILATVLYGFIARILFLNPIPSDPKENSKTWKNDSTH
QNKNMNLNTTNRCFNSTVSSRKQVTKMLAVVVILFALLWMPYRTLVVVNSFLSSPFQENW
FLLFCRICIYLNSAINPVIYNLMSQKFRAAFRKLCNCKQKPTEKAANYSVALNYSVIKES
DRFSTELDDITVTDTYVSTTKVSFDDTCLASEKNGPSSCTYGYSLTAKQEKI
NT seq 1239 nt   +upstreamnt  +downstreamnt
atggagaatgaaaccgtcagtgaactgaaccaaaccgagctcccgccgcaagtagccgtg
gccctcgagtaccaggtggtcaccatcttacttgtggtggttatctgtggactgggcatt
gtgggcaacatcatggtagtcctggtggtcatgagaacgaagcacatgagaaccgctaca
aactgctacctggtgagtctggctgtggcggatctcatggtcctggtggctgcaggcctc
cccaacatcaccgacagcatctatggttcctgggtctatggctatgttggctgcctctgc
atcacgtatctccagtacttaggaattaacgcatcttcatgctcaataacagcctttacc
attgagaggtacatagcaatctgccaccccatcaaagcccagtttctgtgcacattttcc
agagccaaaaaaatcattatctttgtctgggcctttacatccatttactgtatgctgtgg
ttcttccttctggatctcaatatcagcacctacaaagatgctattgtgatatcctgtggc
tacaagatctcccgcaactactactcacctatttacctaatggactttggcgtcttttat
gtcatgccaatgatcctggccactgtgctttacgggtttatagctagaatcctcttctta
aaccccattccttcagaccctaaagaaaactctaagacgtggaaaaatgactcaacccat
cagaacaagaatatgaatttaaacaccaccaacagatgtttcaacagcaccgtttcttcc
aggaagcaggtcaccaagatgcttgcagtggttgtaattctgtttgcccttttatggatg
ccctacaggactcttgtggttgtcaactcatttctctccagccctttccaggaaaattgg
ttcttgctcttttgcagaatttgcatttatctcaacagtgccatcaacccggtgatttac
aacctcatgtctcagaagtttcgtgcagccttcaggaagctctgcaattgcaagcagaag
cccactgagaaagctgctaactacagtgtggccctaaattacagtgtcatcaaggagtca
gaccgctttagcacagagctagatgacatcaccgtcactgacacgtatgtgtcaaccaca
aaagtatcatttgatgacacctgcttggcctccgagaagaatggacccagttcttgtaca
tatggatattctttgactgccaaacaggagaaaatatga

DBGET integrated database retrieval system