KEGG   Rattus norvegicus (rat): 25572Help
Entry
25572             CDS       T01003                                 

Gene name
Tnfrsf4, Ox40, Txgp1
Definition
(RefSeq) TNF receptor superfamily member 4
  KO
K05142  tumor necrosis factor receptor superfamily member 4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    25572 (Tnfrsf4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:rno04050]
    25572 (Tnfrsf4)
   04090 CD molecules [BR:rno04090]
    25572 (Tnfrsf4)
Cytokine receptors [BR:rno04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   25572 (Tnfrsf4)
CD molecules [BR:rno04090]
 Proteins
  25572 (Tnfrsf4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNFR_c6 Ephrin_rec_like
Motif
Other DBs
NCBI-GeneID: 25572
NCBI-ProteinID: NP_037181
RGD: 3920
Ensembl: ENSRNOG00000020106
UniProt: P15725
Position
5q36
AA seq 271 aa AA seqDB search
MYVWVQQPTAFLLLGLSLGVTVKLNCVKDTYPSGHKCCRECQPGHGMVSRCDHTRDTVCH
PCEPGFYNEAVNYDTCKQCTQCNHRSGSELKQNCTPTEDTVCQCRPGTQPRQDSSHKLGV
DCVPCPPGHFSPGSNQACKPWTNCTLSGKQIRHPASNSLDTVCEDRSLLATLLWETQRTT
FRPTTVPSTTVWPRTSQLPSTPTLVAPEGPAFAVILGLGLGLLAPLTVLLALYLLRKAWR
SPNTPKPCWGNSFRTPIQEEQTDTHFTLAKI
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgtatgtgtgggttcagcagcccacagcatttctgctcctgggactctcacttggagtt
acagtgaagctcaactgtgttaaagatacctaccccagtggtcacaagtgctgtcgtgag
tgccagccaggccatggtatggtgagccgctgtgatcacaccagggacactgtatgtcat
ccatgtgagcctggcttctacaatgaggctgtcaattacgacacctgcaagcagtgtaca
cagtgcaaccaccgaagtggaagtgaactcaagcagaactgcacacctactgaggatact
gtctgccagtgtagaccaggcacccaaccccggcaagacagcagccacaagcttggagtt
gactgtgttccctgcccccctggccacttttctccaggcagcaaccaagcctgcaagccc
tggaccaattgtaccttatctggaaagcagatccgccacccagccagtaacagcttggac
acagtctgtgaagacagaagcctcctggccacactgctctgggagacccagcgcactaca
ttcaggccaaccactgtcccgtccaccacagtctggcccaggacttctcagttgccctct
acacccaccttggtggctcctgagggccctgcatttgctgttatcctaggcctaggcctg
ggcttgctggctcccttgactgtcctgctagccttgtacctgctccgaaaggcttggaga
tcgcccaacactcccaaaccttgttggggaaacagcttcaggacccctatccaggaggag
cagaccgacacacactttactctagccaagatctga

DBGET integrated database retrieval system