KEGG   Rattus norvegicus (rat): 25578Help
Entry
25578             CDS       T01003                                 

Gene name
Ywhaz, 14-3-3z
Definition
(RefSeq) tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta
  KO
K16197  14-3-3 protein beta/theta/zeta
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04110  Cell cycle
rno04114  Oocyte meiosis
rno04151  PI3K-Akt signaling pathway
rno04390  Hippo signaling pathway
rno05160  Hepatitis C
rno05161  Hepatitis B
rno05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    25578 (Ywhaz)
   04151 PI3K-Akt signaling pathway
    25578 (Ywhaz)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    25578 (Ywhaz)
   04114 Oocyte meiosis
    25578 (Ywhaz)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    25578 (Ywhaz)
  09172 Infectious disease: viral
   05161 Hepatitis B
    25578 (Ywhaz)
   05160 Hepatitis C
    25578 (Ywhaz)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:rno03400]
    25578 (Ywhaz)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    25578 (Ywhaz)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic Type
  Check point factors
   Other check point factors
    25578 (Ywhaz)
Exosome [BR:rno04147]
 Exosomal proteins
  Proteins found in most exosomes
   25578 (Ywhaz)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 14-3-3 AAA_15 CSN7a_helixI FliM Peptidase_C98
Motif
Other DBs
NCBI-GeneID: 25578
NCBI-ProteinID: NP_037143
RGD: 3980
Ensembl: ENSRNOG00000008195
UniProt: P63102
Position
7q22
AA seq 245 aa AA seqDB search
MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWR
VVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQPESKVFYLK
MKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYE
ILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAG
EGGEN
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atggataaaaatgagctggtgcagaaggccaagctggccgagcaggcagagcgatacgat
gacatggcagcctgcatgaagtctgtcactgagcaaggagccgagctgtctaacgaggag
aggaaccttctctctgttgcttataaaaacgttgtaggagcccgtaggtcatcttggagg
gtcgtctcgagtattgagcagaagacggaaggtgctgagaaaaagcagcagatggctcga
gaatacagagagaagatcgagacggagctgagggacatctgcaacgacgtactgtctctt
ttggaaaagttcttgatccccaatgcttcgcagccagaaagcaaagtcttctatttgaaa
atgaagggtgactactaccgctacttggctgaggttgctgctggtgatgacaagaaagga
attgtggaccagtcacagcaagcataccaagaagcatttgaaatcagcaaaaaggagatg
cagccgacacaccccatcagactgggtctggccctcaacttctctgtgttctactatgag
atcctgaactccccagagaaagcctgctctcttgcaaaaacagcttttgatgaagccatt
gctgaacttgatacattaagtgaagagtcgtacaaagacagcacgctaataatgcagtta
ctgagagacaacttgacattgtggacatcggatacccaaggagacgaagcagaagcggga
gaaggaggggaaaattaa

DBGET integrated database retrieval system