KEGG   Rattus norvegicus (rat): 25582
Entry
25582             CDS       T01003                                 

Gene name
Agrp
Definition
(RefSeq) agouti related neuropeptide
  KO
K05231  agouti related protein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    25582 (Agrp)
SSDB
Motif
Pfam: Agouti DUF4190 Toxin_9
Other DBs
NCBI-GeneID: 25582
NCBI-ProteinID: NP_387499
RGD: 2068
Ensembl: ENSRNOG00000039001
UniProt: F1MAG1
Position
19q12
AA seq 129 aa
MLTAMLLSCVLLLALPPTLGVHMGVAPLKGIRRSDQALFPEFSGLSLKKTAADRAEDVLL
QKAEALAEVLDPQNRESRSPRRCVRLHESCLGQQVPCCDLCATCYCRFFNTFCYCRKLGT
GTTNLCSRP
NT seq 390 nt   +upstreamnt  +downstreamnt
atgctgactgcaatgttgctgagctgtgtcctgctgctggcactgcctcccacattgggg
gtccatatgggcgtggcaccactgaagggcatcagaaggtctgaccaggccctgttccca
gagttctcaggtctaagtctgaagaagacagcagcagaccgagcagaagatgttctgctg
cagaaggcagaagctttggcagaggtgctagatccacagaaccgcgagtctcgttctccg
cgtcgctgtgtaaggctgcacgagtcctgcttgggacaacaggtaccttgctgcgacctg
tgcgccacgtgctactgccgcttcttcaataccttttgctactgccgcaagctaggtact
ggcaccacgaacctctgcagccgcccctag

DBGET integrated database retrieval system