KEGG   Rattus norvegicus (rat): 25583
Entry
25583             CDS       T01003                                 

Gene name
Cryba1, BA3A1C, beta-A3
Definition
(RefSeq) crystallin, beta A1
  KO
K23482  beta-crystallin
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    25583 (Cryba1)
SSDB
Motif
Pfam: Crystall Inhibitor_I36 DUF2914
Other DBs
NCBI-GeneID: 25583
NCBI-ProteinID: NP_037188
RGD: 2415
Ensembl: ENSRNOG00000008700
UniProt: P14881
Position
10q25
AA seq 215 aa
METQTVQRELETLPTTKMAQTNPMPGSMGPWKITIYDQENFQGKRMEFTSSCPNVSERSF
DNVRSLKVECGAWIGYEHTSFCGQQFILERGEYPRWDAWSGSNAYHIERLMSFRPICSAN
HKESKITIFEKENFIGRQWEICDDYPSLQAMGWFNNEVGSMKIQCGAWVCYQYPGYRGYQ
YILECDHHGGDYKHWREWGTHAQTSQIQSIRRIQQ
NT seq 648 nt   +upstreamnt  +downstreamnt
atggagacccagactgtgcagcgggagctggaaactcttccaaccaccaagatggctcag
accaaccctatgccagggtccatggggccatggaagataaccatctatgatcaggagaac
ttccagggcaagaggatggagttcaccagctcctgcccaaatgtctctgaacgtagtttt
gataatgtccggtcacttaaggtggagtgtggcgcctggattggttatgagcacaccagc
ttctgtgggcaacagttcatcctggagagaggagaataccctcgatgggatgcctggagt
gggagcaatgcctatcatattgagcgtctcatgtccttccgacccatctgttctgctaat
cataaagagtctaagatcaccatctttgagaaagagaactttattggacgccagtgggag
atctgtgatgactacccttccttacaagccatgggttggttcaacaatgaagtgggttcc
atgaagatacagtgtggagcttgggtttgctaccagtatcctggatatcgtggttatcag
tatatcttggaatgtgaccatcacggaggagactacaaacactggagagagtggggaact
catgctcagacttctcagatccaatcaattcgccgaatacaacaatag

DBGET integrated database retrieval system