KEGG   Rattus norvegicus (rat): 25584
Entry
25584             CDS       T01003                                 

Gene name
F3
Definition
(RefSeq) tissue factor precursor
  KO
K03901  coagulation factor III (tissue factor)
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04610  Complement and coagulation cascades
rno04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    25584 (F3)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    25584 (F3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:rno04090]
    25584 (F3)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
    25584 (F3)
CD molecules [BR:rno04090]
 Proteins
  25584 (F3)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
 Others
  25584 (F3)
SSDB
Motif
Pfam: Interfer-bind Tissue_fac Adeno_E3_CR2 Baculo_11_kDa PRIMA1 EphA2_TM Cadherin_C_2
Other DBs
NCBI-GeneID: 25584
NCBI-ProteinID: NP_037189
RGD: 2587
Ensembl: ENSRNOG00000011800
UniProt: Q66HI4
Position
2
AA seq 295 aa
MAIPMRPRLLAALAPTFLGFLLLQVAAGAGTPPGKAFNLTWISTDFKTILEWQPKPTNYT
YTVQISDRSRNWKYKCTGTTDTECDLTDEIVKDVNWTYEARVLSVPWRNSTHGKETLFGT
HGEEPPFTNARKFLPYRDTKIGQPVIQKYEQDGTKLKVTVKDSFTLVRKNGTFLTLRQVF
GNDLGYILTYRKDSSTGRKTNTTHTNEFLIDVEKGVSYCFFVQAVIFSRKTNHKSPESIT
KCTEQWKSVLGETLIIVGAVVFLVTVFIILLTISLCKRRKNRAGQKRKNTPSRLA
NT seq 888 nt   +upstreamnt  +downstreamnt
atggctatccccatgcgcccgcgcctcctagcggccctcgcgcccacctttctcggcttc
cttctccttcaggtggccgctggtgcaggcactcctccagggaaagcgtttaatttaact
tggatatcaactgatttcaagacaatcttggagtggcaaccgaaacccaccaactatacc
tacactgttcagataagcgatagatctagaaactggaaatacaaatgcactggaaccaca
gacactgagtgtgacctcaccgacgagattgtgaaggatgtgaactggacctatgaagca
agggtcctatctgtcccatggaggaactcaactcatggaaaggaaacactctttggaact
catggggaggaaccgccatttacaaatgcccggaagtttttaccttaccgagacacaaaa
attggacagccagtaattcagaagtatgaacaagacggtacgaaactgaaggtgactgta
aaagactcatttacattagtcagaaagaatggtacattcctcactctgcggcaagttttt
ggcaatgacttgggttatattcttacgtatcggaaagactcaagcacaggaaggaaaaca
aacactacacataccaatgaattcttgattgatgtggaaaagggggtaagctactgcttc
ttcgtacaagccgtgattttctccaggaaaactaaccacaagagcccagaaagcatcacc
aagtgcactgagcaatggaagagtgtcctgggagaaacactcatcattgtgggagcagtg
gtgttcctggtcactgtctttatcatcctgctgaccatatctctgtgcaagcgcagaaag
aacagagcaggacagaaaaggaagaacaccccgtcgcgcttggcatag

DBGET integrated database retrieval system