KEGG   Rattus norvegicus (rat): 25585Help
Entry
25585             CDS       T01003                                 

Gene name
Id3
Definition
(RefSeq) inhibitor of DNA binding 3, HLH protein
  KO
K17694  DNA-binding protein inhibitor ID3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04350  TGF-beta signaling pathway
rno04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    25585 (Id3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    25585 (Id3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    25585 (Id3)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   HLH domain only
    25585 (Id3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HLH
Motif
Other DBs
NCBI-GeneID: 25585
NCBI-ProteinID: NP_037190
RGD: 2860
Ensembl: ENSRNOG00000026124
UniProt: P41138
Position
5q36
AA seq 119 aa AA seqDB search
MKALSPVRGCYEAVCCLSERSLAIARGRGKSPSAEEPLSLLDDMNHCYSRLRELVPGVPR
GTQLSQVEILQRVIDYILDLQVVLAEPAPGPPDGPHLPIQTAELTPELVISKDKRSFCH
NT seq 360 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcgctgagcccggtgcgcggctgctacgaggcggtgtgctgcctgtcggaacgt
agcctagccattgcgcgaggccggggtaagagcccgtcggcggaggagccgcttagcctc
ttggacgacatgaaccactgctactcgcgcctgcgggaactggtgccgggagtcccgcgg
ggcactcagcttagccaggtggaaatcctgcagcgtgtcatagactacatcctcgacctt
caagtggttctggcagagcccgcgcctggacccccggatggtccgcatctcccgatccag
acagctgagctcactccggaacttgtgatctccaaggacaagaggagtttttgccactga

DBGET integrated database retrieval system