KEGG   Rattus norvegicus (rat): 25586
Entry
25586             CDS       T01003                                 

Symbol
Alpl
Name
(RefSeq) alkaline phosphatase, tissue-nonspecific isozyme precursor
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00730  Thiamine metabolism
rno00790  Folate biosynthesis
rno01100  Metabolic pathways
rno01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    25586 (Alpl)
   00790 Folate biosynthesis
    25586 (Alpl)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    25586 (Alpl)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
    25586 (Alpl)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     25586 (Alpl)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   25586 (Alpl)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
 Enzymes
  25586 (Alpl)
SSDB
Motif
Pfam: Alk_phosphatase Metalloenzyme
Other DBs
NCBI-GeneID: 25586
NCBI-ProteinID: NP_037191
RGD: 2100
Ensembl: ENSRNOG00000013954
UniProt: P08289
Position
5:complement(149951397..150006424)
AA seq 524 aa
MILPFLVLAIGTCLTNSFVPEKEKDPSYWRQQAQETLKNALKLQKLNTNVAKNIIMFLGD
GMGVSTVTAARILKGQLHHNTGEETRLEMDKFPFVALSKTYNTNAQVPDSAGTATAYLCG
VKANEGTVGVSAATERTRCNTTQGNEVTSILRWAKDAGKSVGIVTTTRVNHATPSAAYAH
SADRDWYSDNEMPPEALSQGCKDIAYQLMHNIKDIDVIMGGGRKYMYPKNRTDVEYELDE
KARGTRLDGLDLISIWKSFKPRHKHSHYVWNRTELLALDPSRVDYLLGLFEPGDMQYELN
RNNLTDPSLSEMVEVALRILTKNPKGFFLLVEGGRIDHGHHEGKAKQALHEAVEMDEAIG
KAGTMTSQKDTLTVVTADHSHVFTFGGYTPRGNSIFGLAPMVSDTDKKPFTAILYGNGPG
YKVVDGERENVSMVDYAHNNYQAQSAVPLRHETHGGEDVAVFAKGPMAHLLHGVHEQNYI
PHVMAYASCIGANLDHCAWASSASSPSPGALLLPLALFPLRTLF
NT seq 1575 nt   +upstreamnt  +downstreamnt
atgatcttgccatttttagtactggccatcggcacctgccttaccaactcatttgtgcca
gagaaagagaaagaccccagttactggcgacagcaagcccaagagaccttgaaaaatgcc
ctgaaactccaaaaactcaacaccaacgtggccaagaacatcatcatgttcctgggagat
ggtatgggcgtctccacagtgacagctgcccgcatccttaagggccagctacaccacaac
acgggcgaggagacacggctggagatggacaagttcccctttgtggctctctccaagacg
tacaacaccaacgctcaggtccccgacagcgcgggcactgccactgcctacttgtgtggc
gtgaaggccaacgagggcaccgtgggagtgagcgcggccactgagcgcacgcgatgcaac
accactcaggggaacgaggtcacgtccatcctgcgctgggccaaggatgctgggaagtcc
gtgggcatcgtgaccaccactcgggtgaaccacgccactcccagtgcagcctatgcgcac
tcggccgatcgggactggtactcggacaatgagatgccgccagaggctctgagccagggc
tgcaaggacatcgcctatcagctaatgcacaacatcaaggacatcgatgtgatcatgggt
ggcggccggaagtacatgtaccccaagaacagaactgatgtggaatatgaactggatgag
aaggccaggggcaccagactggatggcctggacctcatcagcatttggaagagcttcaaa
cctagacacaagcactcccactatgtctggaaccgcactgaactgctggcccttgacccc
tccagggtggactacctcttaggtctctttgagcccggggacatgcagtatgagttgaat
cggaacaacctgactgacccttccctctcggagatggtggaggtggccctccggatcctg
acaaagaatcccaaaggcttcttcttgctagtggaaggaggcaggattgaccacgggcac
catgaaggcaaggccaagcaggcgctgcatgaggccgtggagatggatgaggccatcgga
aaggcgggcaccatgacttcccagaaagacacgttgactgtggttactgctgatcactcc
cacgttttcacgtttggtggctacacccccaggggcaactccatttttggtctggctccc
atggtgagtgacacggacaagaagcccttcacagccatcctgtatggcaacgggcctggt
tacaaggtggtggacggtgaacgggagaacgtctccatggtggattatgctcacaacaac
taccaggcccagtccgctgtccccctgcggcacgagacccacggtggggaagatgtggcg
gtctttgccaagggccctatggctcacctgcttcacggcgtccatgagcagaactacatc
ccccacgtcatggcgtatgcctcctgcattggagccaaccttgaccactgtgcctgggcc
agctctgcgagcagcccctccccaggggccctgctgcttccactggctctgttcccccta
cgcaccctgttctga

DBGET integrated database retrieval system