KEGG   Rattus norvegicus (rat): 25590Help
Entry
25590             CDS       T01003                                 

Gene name
Chrna4, NARAC
Definition
(RefSeq) cholinergic receptor nicotinic alpha 4 subunit
  KO
K04806  nicotinic acetylcholine receptor alpha-4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04080  Neuroactive ligand-receptor interaction
rno04725  Cholinergic synapse
rno05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    25590 (Chrna4)
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    25590 (Chrna4)
 09160 Human Diseases
  09165 Substance dependence
   05033 Nicotine addiction
    25590 (Chrna4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    25590 (Chrna4)
Ion channels [BR:rno04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   25590 (Chrna4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Neur_chan_memb Neur_chan_LBD
Motif
Other DBs
NCBI-GeneID: 25590
NCBI-ProteinID: NP_077330
RGD: 2346
Ensembl: ENSRNOG00000011202
Vega: OTTRNOG00000002266
UniProt: P09483
Position
3q43
AA seq 630 aa AA seqDB search
MANSGPGAPPPLLLLPLLLLLGTGLLPASSHIETRAHAEERLLKRLFSGYNKWSRPVGNI
SDVVLVRFGLSIAQLIDVDEKNQMMTTNVWVKQEWHDYKLRWDPGDYENVTSIRIPSELI
WRPDIVLYNNADGDFAVTHLTKAHLFYDGRVQWTPPAIYKSSCSIDVTFFPFDQQNCTMK
FGSWTYDKAKIDLVSIHSRVDQLDFWESGEWVIVDAVGTYNTRKYECCAEIYPDITYAFI
IRRLPLFYTINLIIPCLLISCLTVLVFYLPSECGEKVTLCISVLLSLTVFLLLITEIIPS
TSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPRTHTMPAWVRRVFLDIVPRLLFM
KRPSVVKDNCRRLIESMHKMANAPRFWPEPVGEPGILSDICNQGLSPAPTFCNPTDTAVE
TQPTCRSPPLEVPDLKTSEVEKASPCPSPGSCPPPKSSSGAPMLIKARSLSVQHVPSSQE
AAEDGIRCRSRSIQYCVSQDGAASLADSKPTSSPTSLKARPSQLPVSDQASPCKCTCKEP
SPVSPVTVLKAGGTKAPPQHLPLSPALTRAVEGVQYIADHLKAEDTDFSVKEDWKYVAMV
IDRIFLWMFIIVCLLGTVGLFLPPWLAGMI
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atggccaattcgggccccggggcgccgccgccgctgctgctactgccgctgctgctgctc
ctagggaccggcctcttgcctgctagcagccacatagagacccgggcccatgcggaggag
cggctcctgaagagactcttctccggttacaacaagtggtctcggccagtaggcaatatc
tcagatgtggtcctcgtccgctttggcttgtccattgctcagctcattgacgtggacgag
aagaaccagatgatgacaaccaacgtgtgggtgaagcaggagtggcacgactacaagctg
cgctgggaccctggtgactacgagaatgtcacctccatccgcatcccctctgaactcatc
tggaggcctgacatcgtcctctacaacaatgcggatggagactttgcagtcacccacctg
accaaggcccacctgttctatgacggaagggtgcagtggacacccccagccatctataag
agctcctgcagcatcgacgtcaccttcttcccctttgaccagcagaactgtaccatgaag
tttggatcctggacctacgacaaggccaagattgacttagtgagcattcatagccgtgtg
gaccaactggacttctgggaaagtggggagtgggtcatcgtggatgctgtgggcacctac
aacaccaggaagtacgagtgctgtgccgagatctatcctgacatcacctatgccttcatc
atccgacgcctgccgctattctacaccatcaacctcatcatcccgtgcctgctcatctcc
tgtctcaccgtgctggtcttctatctgccttcagagtgtggcgagaaggtcacactgtgc
atctcggtgctgctttctctcaccgtcttcctgctgctcatcaccgagatcatcccgtcc
acctcgctggtcatcccgctcatcggcgagtacctcctcttcaccatgatcttcgtcacc
ctctccatcgtcatcacggtcttcgtgctcaatgtgcaccaccgctcgccacgcacacac
acgatgcccgcctgggtgcgtagagtcttcctggacatcgtgcctcgcctcctcttcatg
aagcgcccctctgtggtcaaagacaactgccggagacttattgagtccatgcacaagatg
gccaacgccccccgcttctggccagagcctgtgggcgagcccggcatcttgagtgacatc
tgcaaccaaggtctgtcacctgccccaactttctgcaaccccacggacacagcagtcgag
acccagcctacgtgcaggtcacccccccttgaggtccctgacttgaagacatcagaggtt
gagaaggccagtccctgtccatcgcctggctcctgtcctccacccaagagcagcagtggg
gctccaatgctcatcaaagccaggtccctgagtgtccagcatgtgcccagctcccaagaa
gcagcagaagatggcatccgctgccggtctcggagtatccagtactgtgtttcccaagat
ggagctgcctccctggctgacagcaagcccaccagctccccgacctccctgaaggcccgt
ccatcccagcttcccgtgtcagaccaggcctctccatgcaaatgcacatgcaaggaacca
tctcctgtgtccccagtcactgtgctcaaggcgggaggcaccaaagcacctccccaacac
ctgcccctgtcaccagccctgacacgggcagtagaaggcgtccagtacattgcagaccac
ctcaaggcagaagacactgacttctcggtgaaggaggactggaaatacgtggccatggtc
attgaccgaatcttcctctggatgttcatcattgtctgccttctgggcactgtgggactc
ttcctgcctccctggctggctggtatgatctag

DBGET integrated database retrieval system