KEGG   Rattus norvegicus (rat): 25592
Entry
25592             CDS       T01003                                 

Symbol
Agrn
Name
(RefSeq) agrin
  KO
K06254  agrin
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    25592 (Agrn)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:rno00535]
    25592 (Agrn)
Proteoglycans [BR:rno00535]
 Extracellular matrix (ECM) proteoglycans
  Basement membrane proteoglycans
   25592 (Agrn)
SSDB
Motif
Pfam: Laminin_G_1 Kazal_2 Laminin_G_2 Kazal_1 Laminin_EGF SEA EGF Laminin_G_3
Other DBs
NCBI-GeneID: 25592
NCBI-ProteinID: NP_786930
RGD: 2067
Ensembl: ENSRNOG00000020205
UniProt: P25304
Structure
PDB: 
3V64 3V65

Position
5
AA seq 1940 aa
MPPLPLEHRPRQEPGASMLVRYFMIPCNICLILLATSTLGFAVLLFLSNYKPGIHFTPAP
PTPPDVCRGMLCGFGAVCEPSVEDPGRASCVCKKNACPATVAPVCGSDASTYSNECELQR
AQCNQQRRIRLLRQGPCGSRDPCANVTCSFGSTCVPSADGQTASCLCPTTCFGAPDGTVC
GSDGVDYPSECQLLSHACASQEHIFKKFNGPCDPCQGSMSDLNHICRVNPRTRHPEMLLR
PENCPAQHTPICGDDGVTYENDCVMSRIGATRGLLLQKVRSGQCQTRDQCPETCQFNSVC
LSRRGRPHCSCDRVTCDGSYRPVCAQDGHTYNNDCWRQQAECRQQRAIPPKHQGPCDQTP
SPCHGVQCAFGAVCTVKNGKAECECQRVCSGIYDPVCGSDGVTYGSVCELESMACTLGRE
IQVARRGPCDPCGQCRFGSLCEVETGRCVCPSECVESAQPVCGSDGHTYASECELHVHAC
THQISLYVASAGHCQTCGEKVCTFGAVCSAGQCVCPRCEHPPPGPVCGSDGVTYLSACEL
REAACQQQVQIEEAHAGPCEPAECGSGGSGSGEDDECEQELCRQRGGIWDEDSEDGPCVC
DFSCQSVPRSPVCGSDGVTYGTECDLKKARCESQQELYVAAQGACRGPTLAPLLPVAFPH
CAQTPYGCCQDNFTAAQGVGLAGCPSTCHCNPHGSYSGTCDPATGQCSCRPGVGGLRCDR
CEPGFWNFRGIVTDGHSGCTPCSCDPRGAVRDDCEQMTGLCSCRPGVAGPKCGQCPDGQV
LGHLGCEADPMTPVTCVEIHCEFGASCVEKAGFAQCICPTLTCPEANSTKVCGSDGVTYG
NECQLKAIACRQRLDISTQSLGPCQESVTPGASPTSASMTTPRHILSKTLPFPHNSLPLS
PGSTTHDWPTPLPISPHTTVSIPRSTAWPVLTVPPTAAASDVTSLATSIFSESGSANGSG
DEELSGDEEASGGGSGGLEPPVGSIVVTHGPPIERASCYNSPLGCCSDGKTPSLDSEGSN
CPATKAFQGVLELEGVEGQELFYTPEMADPKSELFGETARSIESTLDDLFRNSDVKKDFW
SVRLRELGPGKLVRAIVDVHFDPTTAFQASDVGQALLRQIQVSRPWALAVRRPLQEHVRF
LDFDWFPTFFTGAATGTTAAMATARATTVSRLPASSVTPRVYPSHTSRPVGRTTAPPTTR
RPPTTATNMDRPRTPGHQQPSKSCDSQPCLHGGTCQDQDSGKGFTCSCTAGRGGSVCEKV
QPPSMPAFKGHSFLAFPTLRAYHTLRLALEFRALETEGLLLYNGNARGKDFLALALLDGR
VQFRFDTGSGPAVLTSLVPVEPGRWHRLELSRHWRQGTLSVDGETPVVGESPSGTDGLNL
DTNLYVGGIPEEQVAMVLDRTSVGVGLKGCIRMLDINNQQLELSDWQRAAVQSSGVGECG
DHPCLPNPCHGGALCQALEAGMFLCQCPPGRFGPTCADEKSPCQPNPCHGAAPCRVLSSG
GAKCECPLGRSGTFCQTVLETAGSRPFLADFNGFSYLELKGLHTFERDLGEKMALEMVFL
ARGPSGLLLYNGQKTDGKGDFVSLALHNRHLEFCYDLGKGAAVIRSKEPIALGTWVRVFL
ERNGRKGALQVGDGPRVLGESPKSRKVPHTMLNLKEPLYIGGAPDFSKLARGAAVSSGFN
GVIQLVSLRGHQLLTQEHVLRAVDVSPFADHPCTQALGNPCLNGGSCVPREATYECLCPG
GFSGLHCEKGLVEKSVGDLETLAFDGRTYIEYLNAVIESEKALQSNHFELSLRTEATQGL
VLWIGKAAERADYMALAIVDGHLQLSYDLGSQPVVLRSTVKVNTNRWLRIRAHREHREGS
LQVGNEAPVTGSSPLGATQLDTDGALWLGGLQKLPVGQALPKAYGTGFVGCLRDVVVGHR
QLHLLEDAVTKPELRPCPTP
NT seq 5823 nt   +upstreamnt  +downstreamnt
atgcctcctctgccactggaacacagacccaggcaggagcctggtgcctccatgctggtt
cgatacttcatgatcccctgcaacatctgcttgatcctgttggccacttccacattgggc
tttgcggttctgcttttcctcagcaactacaaacctggaatccacttcacaccagcgcct
cctacgcctcctgatgtatgcaggggaatgttatgtggctttggtgctgtgtgtgaacct
agtgttgaggatccaggccgtgcctcctgtgtgtgcaagaagaatgcttgccctgctacg
gtggctcctgtgtgtggctcagatgcctccacctatagcaacgagtgcgagctgcagcgc
gcgcagtgcaaccagcaacggcgcatccgcctgcttcgccaagggccatgtgggtcccgg
gacccctgtgccaacgtgacctgcagtttcggtagtacctgtgtaccttcggctgacgga
cagactgcctcatgtctgtgtcctacaacctgcttcggggcccctgatggcacagtgtgt
ggcagtgacggtgttgactaccctagtgaatgccagctgcttagtcatgcctgtgccagc
caggagcacatcttcaagaagttcaatggtccttgtgatccctgccagggcagcatgtca
gacctgaaccacatttgccgtgtgaacccacgtacacggcacccagaaatgcttctgcgg
cctgagaactgccctgcccagcacacgcctatctgtggagatgatggggtcacctatgaa
aacgactgtgtcatgagccgtataggtgcaacccgtggcctgcttctccagaaagtacgc
tctggtcaatgccaaactcgagaccagtgcccggagacctgccagtttaactccgtatgc
ctgtcccgccgtggccgtccccactgttcctgcgatcgtgtcacctgtgatgggtcttac
aggcctgtgtgtgcccaagatgggcacacatacaacaatgactgttggcgccaacaggct
gagtgtcgacaacagcgggccattcctcccaagcaccagggcccgtgtgaccagaccccg
tccccatgccatggagtgcaatgtgcatttggggcagtatgcacagtgaagaacgggaaa
gccgagtgtgagtgccagcgggtgtgctccggcatctacgatcctgtgtgcggcagtgac
ggtgtcacttacggcagtgtgtgcgagctggaatccatggcctgtacccttgggcgggaa
atccaagtggcccgcagaggaccctgtgacccatgtgggcagtgccgttttggatccctg
tgcgaggtggaaactggacgctgtgtgtgcccctctgagtgtgtggagtcagcccagccc
gtatgcggttctgatggacacacatacgctagtgaatgtgagctgcatgtccacgcctgt
acgcaccagatcagcctatacgtggcctcagctggacactgccagacctgtggagaaaaa
gtttgtacttttggggctgtgtgctcagctggacagtgtgtatgtccccgttgtgagcac
cctccacctggccctgtgtgtggcagtgatggtgtcacctacctcagtgcctgtgagcta
cgcgaagctgcctgtcagcagcaggtacaaattgaggaggcccatgcagggccatgtgag
ccggctgagtgtggctcagggggctctggttctggggaggacgacgagtgtgaacaggag
ctatgccggcagcgtggtggtatctgggacgaggactcagaagatgggccatgtgtctgt
gactttagctgccagagtgtccctagaagcccagtgtgtggctcggatggagtcacctat
ggcaccgagtgtgatctgaagaaggccaggtgcgaatcacagcaagaactgtacgttgct
gctcagggagcctgccgtggccctaccttggctccactgctacctgtggccttcccacac
tgtgcccaaaccccctatggctgctgccaggacaatttcactgctgcccagggtgtgggc
ttggctggctgtcccagcacctgccattgcaacccccatggctcctacagtggcacttgt
gacccagccacagggcagtgctcctgccgaccaggtgtaggaggcctcaggtgtgatcgc
tgtgaacctggcttctggaacttccgtggcatcgtcaccgatggacatagtggttgcact
ccctgcagctgcgaccctcggggtgccgtaagggatgactgtgaacagatgactggattg
tgttcctgtaggcctggtgtggctggtcccaagtgtggacagtgtccagatggtcaagtc
ctgggccatctaggctgtgaagcagatcccatgacacctgtgacttgtgtggagatacac
tgcgagttcggggcctcctgcgtagagaaggctggttttgcccaatgtatctgcccaacc
ctcacatgtccagaggctaactctaccaaggtctgcggatcagacggtgtgacatatggc
aatgaatgccagctgaaggccattgcctgccgccagcgtctggacatctccactcagagt
cttggtccctgccaggagagtgttactcctggggcttccccaacatctgcatctatgact
accccaaggcatatcctgagcaagacgctgccatttccccacaacagccttcctctgtct
cccggcagtactacccatgattggcccaccccattacccatatcacctcacaccacagtc
agcatccccagaagcaccgcgtggcctgtgctgaccgtgccccctacagcagcagcctct
gacgtaaccagtctcgcaacatcaatcttcagtgaatccggcagcgccaatgggagtggc
gacgaggaactgagtggagatgaggaggccagtgggggcgggtctgggggacttgagccc
ccggtgggcagcattgtggtgacccatgggccacccatcgagagggcttcctgctacaac
tcacctttgggctgctgctcagatggcaagacaccctcactggactccgaaggctccaac
tgtcctgctaccaaggcattccagggcgtgctggagcttgagggggtcgagggacaggaa
ctgttctacacacctgagatggctgaccccaagtcagagttgtttggggagaccgcaagg
agcattgaaagcacgctggacgacctgttccggaattcagacgtcaagaaggacttctgg
agtgtccgcctacgggaactggggcctggcaagttggtccgcgccattgtggacgttcac
tttgaccctaccacagccttccaggcatcagatgtgggtcaggccttgctccgacagatc
caggtatctaggccatgggccctggcagtgaggaggcctctgcaggaacatgtgcgattc
ttagactttgactggtttcccactttctttacgggagctgcaacaggaactacagctgct
atggccacagccagagccaccactgtgagccgactgccggcctcttccgtcaccccacga
gtctaccccagtcacaccagccggcctgttggcagaactacagcaccaccaaccactcgc
cggccaccaaccactgccaccaacatggaccggcctcggaccccaggccatcaacagccc
tcaaagtcctgtgattcccaaccttgcctccatggaggtacctgccaggaccaggattct
ggcaagggtttcacctgcagctgtactgcaggcaggggtggctctgtctgtgagaaagta
caacccccctccatgccagcttttaagggccactccttcttggccttccccaccctccga
gcctaccacacactgcgcctagcactggaattccgggctttggagacagagggactgcta
ctctacaatggcaatgcacgtggcaaagatttcctggctctggctctgttggatgggcgt
gtgcagttcaggtttgacacaggctcagggccagcagtgctaacgagcttagtgccagtg
gaaccaggacggtggcaccgcctcgagttgtcacggcattggcgtcagggcacactttct
gtggatggcgagactcctgttgtaggtgaaagtcccagtggcaccgatggcctcaacttg
gacacgaacctctatgtgggtggtatcccagaagaacaagttgccatggtgcttgatcgg
acctctgtgggcgttggcctgaaaggatgcattcgtatgctggatatcaacaatcagcag
ctggagcttagcgactggcagagggctgcggttcaaagctctggtgtgggagaatgtgga
gaccatccgtgcttacctaacccctgccatggtggggccctatgccaggcactggaggct
ggcatgttcctctgtcagtgcccgcctggccgctttggcccaacttgtgcagatgaaaag
agcccctgccagccgaacccctgccatggggcagccccctgtcgtgtgctttccagcggt
ggggccaagtgcgagtgccccctgggacgcagtggtaccttctgtcagacagtcctggag
actgctggctcccggcccttcctggctgactttaatggcttctcctacctggaactgaaa
ggcttgcacaccttcgagagagacctaggggagaagatggcgctggagatggtgttcttg
gctcgtgggcccagtggcttactcctctacaatgggcagaagacagatggcaagggggac
tttgtatccctggccctgcataaccggcacctagagttctgctatgaccttggcaagggg
gctgcagtcatcaggagcaaagagcccatagccctgggaacctgggtcagggtattcctg
gaacgaaatggccgcaagggtgcccttcaagtgggtgatggtccccgtgtgctaggggaa
tctccgaaatcccgcaaggttccgcacaccatgctcaacctcaaggagcctctctatatt
gggggagctcctgacttcagcaagctggccaggggggctgcagtgtcctctggcttcaat
ggtgtcatccagctggtgtctctaagaggccatcaactgctgactcaggagcatgtgttg
cgggcagtagatgtctcaccttttgcagaccacccttgtacccaggccttgggcaacccc
tgccttaatgggggctcgtgtgtcccgagggaagccacttatgaatgcctgtgtcctggg
ggcttctctgggctgcactgcgaaaaggggctagttgagaagtcagtgggggacctagaa
acactggcctttgatgggcggacctacatcgaatacctcaatgctgtgattgagagtgag
aaggcactgcagagcaaccactttgaactgagcttacgcactgaggccactcaggggctg
gtgctgtggattggcaaggctgcagaacgtgcagattacatggccctggccatcgtggac
gggcacctgcaactgagctatgacctaggttcccagccagttgtgctgcgctccactgtg
aaggtcaacaccaaccgctggcttcgaatcagggctcacagggagcacagggaaggttcc
cttcaggtgggcaatgaagcccctgtgactggatcttccccattgggtgccacgcaactg
gacacagatggagccctgtggcttggaggcctgcagaagcttcctgtggggcaggctcta
cccaaggcctatggcacaggttttgtgggctgtctgcgggacgtggtagtgggccatcgc
cagttgcatctgctggaggacgctgtcaccaaaccagagctaagaccctgccccactccc
tga

DBGET integrated database retrieval system