KEGG   Rattus norvegicus (rat): 25593Help
Entry
25593             CDS       T01003                                 

Gene name
Hcrtr1, Hctr1
Definition
(RefSeq) hypocretin receptor 1
  KO
K04238  hypocretin (orexin) receptor 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    25593 (Hcrtr1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    25593 (Hcrtr1)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Peptide
   Orexin
    25593 (Hcrtr1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srw 7tm_4 Orexin_rec2
Motif
Other DBs
NCBI-GeneID: 25593
NCBI-ProteinID: NP_037196
RGD: 2787
Ensembl: ENSRNOG00000013838
UniProt: P56718
Position
5q36
AA seq 416 aa AA seqDB search
MEPSATPGAQPGVPTSSGEPFHLPPDYEDEFLRYLWRDYLYPKQYEWVLIAAYVAVFLIA
LVGNTLVCLAVWRNHHMRTVTNYFIVNLSLADVLVTAICLPASLLVDITESWLFGHALCK
VIPYLQAVSVSVAVLTLSFIALDRWYAICHPLLFKSTARRARGSILGIWAVSLAVMVPQA
AVMECSSVLPELANRTRLFSVCDERWADELYPKIYHSCFFFVTYLAPLGLMGMAYFQIFR
KLWGPQIPGTTSALVRNWKRPSEQLEAQHQGLCTEPQPRARAFLAEVKQMRARRKTAKML
MVVLLVFALCYLPISVLNVLKRVFGMFRQASDREAVYACFTFSHWLVYANSAANPIIYNF
LSGKFREQFKAAFSCCLPGLGPSSSARHKSLSLQSRCSVSKVSEHVVLTTVTTVLS
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atggaaccctcagccacgcctggggcccagcccggagtccccactagcagtggggaaccc
ttccacctgcctccagactatgaggacgagttcctccgctacctgtggcgcgattatctc
tatccgaagcagtacgagtgggttctcatcgcggcctacgtggccgtgtttctcatagcc
ttggtgggcaacactctggtctgcctggctgtgtggcggaaccaccacatgaggacagtc
accaactacttcattgtcaacctgtccctggcagatgtgctggtgactgccatctgcctg
cctgccagcctgttagtggacatcaccgaatcatggctcttcggccatgccttgtgcaag
gtcatcccctatctccaggccgtgtcggtgtcagtggcagtgctgactctcagcttcatc
gccctggaccgctggtatgccatctgccaccctctgctgttcaagagcacagctcgccgt
gcccgtggctccatcctgggcatctgggctgtgtcgctggctgtcatggtgccccaggcc
gctgtcatggaatgcagcagtgttctgcccgagctagccaatcgcacacggctcttctct
gtctgtgatgagcgctgggcagatgaactctaccctaagatctaccacagctgcttcttc
tttgtcacctacctggccccgctgggcctcatgggcatggcctatttccagatcttccgc
aagctctggggcccccagatcccgggtaccacatcggccttggtgcggaactggaagcga
ccctcagagcaactggaagctcagcaccagggcctgtgtacagagccccaaccccgggcc
cgagccttcctggccgaggtgaagcagatgcgagctcggaggaagactgccaagatgctg
atggtggttctgctggtttttgcactctgttatctgcccatcagtgtcctcaatgtcctt
aaaagagtgtttgggatgtttcgccaagccagcgaccgggaagctgtctacgcctgcttc
accttctcccactggctggtgtacgccaacagtgcggccaaccctatcatctacaacttc
ctcagtggcaaatttcgggagcagttcaaggctgcattctcctgctgcctgcctggtctg
ggtcccagctcctctgccagacacaagtccttgtccttgcagagccggtgttctgtctcc
aaagtctctgagcatgttgtgctgaccacagtcactacagtgctgtcctga

DBGET integrated database retrieval system