KEGG   Rattus norvegicus (rat): 25595
Entry
25595             CDS       T01003                                 
Symbol
Map2
Name
(RefSeq) microtubule-associated protein 2
  KO
K10430  microtubule-associated protein 2
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    25595 (Map2)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Microtubule-associated proteins (MAPs)
     25595 (Map2)
SSDB
Motif
Pfam: MAP2_projctn Tubulin-binding RII_binding_1
Other DBs
NCBI-GeneID: 25595
NCBI-ProteinID: NP_037198
RGD: 3044
Ensembl: ENSRNOG00000011841
Vega: OTTRNOG00000002174
UniProt: Q64715
Position
9:67723422..67981886
AA seq 1825 aa
MADERKDEGKAPHWTSASLTEAAAHPHSPEMKDQGGSGEGLSRSANGFPYREEEEGAFGE
HGSQGTYSDTKENGINGELTSADRETAEEVSARIVQVVTAEAVAVLKGEQEKEAQHKDQP
AALPLAAEETVNLPPSPPPSPASEQTAALEEASKMEFPEQQKLPSSFAEPLDKEETEFKM
QSKPGEDFEHAALVPQPDTSKTPQDKKDPQDMEGEKSPASPFAQTFGTNLEDIKQITEPS
ITVPSIGLSAEPLAPKDQKDWFIEMPVESKKDEWGLAAPISPGPLTPMREKDVLEDIPRW
EGKQFDSPMPSPFHSGSFTLPLDTVKDERVTEGSQPFAPVFFQSDDKMSLQDTSGSATSK
ESSKDEEPQKDKADKVADVPVSEATTVLGDVHSPAVEGFVGENISGEEKGTTDQEKKETS
TPSVQEPTLTETEPQTKLEETSKVSIEETVAKEEESLKLKDDKAGVIQTSTEHSFSKEDQ
KGEEQTIEALKQDSFPISLEQAVTDAAMATKTLEKVTSEPEAVSEKREIQGLFEEDIADK
SKLEGAGSATVAEVEMPFYEDKSGMSKYFETSALKEDVTRSTGLGSDYYELSDSRGNAQE
SLDTVSPKNQQDEKELLAKASQPSPPAHEAGYSTLAQSYTSDHPSELPEEPSSPQERMFT
IDPKVYGEKRDLHSKNKDDLTLSRSLGLGGRSAIEQRSMSINLPMSCLDSIALGFNFGRG
HDLSPLASDILTNTSGTMDEGDDYLPPTTPAVEKIPCFPIESKEEEDKTEQAKVTGGQTT
QVETSSESPFPAKEYYKNGTVMAPDLPEMLDLAGTRSRLASVSADAEVARRKSVPSEAVV
AESSTGLPPVADDSQPVKPDSQLEDMGYCVFNKYTVPLPSPVQDSENLSGESGSFYEGTD
DKVRRDLATDLSLIEVKLAAAGRVKDEFTAEKEASPPSSADKSGLSREFDQDRKANDKLD
TVLEKSEEHVDSKEHAKESEEVGDKVELFGLGVTYEQTSAKELITTKETAPERAEKGLSS
VPEVAEVETTTKADQGLDVAAKKDDQSPLDIKVSDFGQMASGMSVDAGKTIELKFEVDQQ
LTLSSEAPQETDSFMGIESSHVKDGAKVSETEVKEKVAKPDLVHQEAVDKEESYESSGEH
ESLTMESLKPDEGKKETSPETSLIQDEVALKLSVEIPCPPPVSEADSSIDEKAEVQMEFI
QLPKEESTETPDIPAIPSDVTQPQPEAVVSEPAEVRGEEEEIEAEGEYDKLLFRSDTLQI
TDLLVPGSREEFVETCPGEHKGVVESVVTIEDDFITVVQTTTDEGELGSHSVRFAAPVQP
EEERRPYPHDEELEVLMAAEAQAEPKDGSPDAPATPEKEEVPFSEYKTETYDDYKDETTI
DDSIMDADSLWVDTQDDDRSILTEQLETIPKEERAEKEARRPSLEKHRKEKPFKTGRGRI
STPERKVAKKEPSTVSRDEVRRKKAVYKKAELAKKSEVQAHSPSRKLILKPAIKYTRPTH
LSCVKRKTTATSGESAQAPSAFKQAKDKVTDGITKSPEKRSSLPRPSSILPPRRGVSGDR
EENSFSLNSSISSARRTTRSEPIRRAGKSGTSTPTTPGSTAITPGTPPSYSSRTPGTPGT
PSYPRTPGTPKFGILVPSEKKVAIIRTPPKSPATPKQLRLINQPLPDLKNVKSKIGSTDN
IKYQPKGGQVQIVTKKIDLSHVTSKCGSLKNIRHRPGGGRVKIESVKLDFKEKAQAKVGS
LDNAHHVPGGGNVKIDSQKLNFREHAKARVDHGAEIITQSPSRSSVASPRRLSNVSSSGS
INLLESPQLATLAEDVTAALAKQGL
NT seq 5478 nt   +upstreamnt  +downstreamnt
atggctgacgagaggaaagacgaaggaaaggcaccacactggacatcagcctcactcaca
gaggcagctgcacacccccactcgccagagatgaaggaccagggtggctcaggggaaggg
ctgagccgcagcgccaatggatttccatacagagaggaggaggaaggcgcctttggggag
cacgggtcacagggcacctattcagataccaaagagaacgggatcaacggagagctgacc
tcagctgacagagaaacagcagaggaagtgtctgcaaggatagttcaagtagtcacagct
gaagctgtagcagtcctgaaaggtgaacaagagaaggaggcccaacacaaggatcagcct
gcagctctgcctttagcagctgaagaaacagttaatctgccaccttccccaccaccatcg
ccagcatcagaacaaacagctgcactggaagaagcctcgaagatggaattccctgagcag
cagaaattgccttcctcattcgctgagcctttagacaaggaggaaacggagtttaagatg
caaagtaagcctggtgaagactttgaacatgctgccttagttcctcagccggacacaagt
aaaactccccaggataaaaaggatccccaagacatggaaggagaaaagtcgcctgccagt
ccatttgcgcagactttcggtaccaacctggaagacataaaacagatcacagaaccaagc
ataacagtacctagcattggcctctccgcagagcccctagctccaaaagatcagaaagac
tggttcatcgaaatgcccgtggaatcaaagaaggatgaatggggtttagctgccccaata
tctcctggccccttgacacccatgagggaaaaagatgtgctggaggatatcccaagatgg
gaaggaaagcagtttgactctcccatgcctagccccttccacagtggaagtttcactctt
cccttagatactgtgaaagatgagagagtcacagaagggtcacaaccctttgcccctgtc
ttcttccaatcagatgacaaaatgtctctgcaggacaccagtggttcagctacttccaaa
gagagttctaaagatgaggagccacagaaagataaagcagacaaagtggcagatgttcct
gtctcagaagctaccactgtactgggagatgttcacagtccagctgtggaaggctttgtc
ggggagaacatttcaggagaagaaaagggtaccacagatcaagagaaaaaagagacttcg
acacccagtgtacaggaacctacactcactgaaactgaaccacagacaaagcttgaagag
acatcaaaggtttccatcgaagaaactgtggcaaaagaagaggaatccttgaaattaaaa
gatgataaagcaggtgtaattcagacttccaccgagcattctttctccaaagaagaccag
aaaggcgaagaacagacaatcgaagcattaaaacaagactcctttcctataagtctagaa
caggcagttacagatgcagccatggccaccaagaccttggaaaaggttacgtctgagcca
gaggcagtaagtgaaaagagagaaatccagggactttttgaagaggatatagctgacaag
agtaagctcgaaggcgctgggtctgcaacagtagccgaggttgagatgccattttatgaa
gataaatcagggatgtccaagtactttgaaacatctgcattgaaagaagatgtgaccaga
agcactgggttgggcagtgattactacgagctgagtgactcaagaggaaatgcccaggaa
tctcttgatactgtatctcccaagaaccaacaagatgaaaaggaacttctggcaaaagct
tcccagcctagtcctccagcacacgaagcagggtacagcactcttgcccagagttataca
tctgatcatccgtccgagttacctgaagaaccaagttctcctcaagaaagaatgttcact
attgaccccaaagtttatggggagaaaagggaccttcatagtaagaacaaagatgatctg
acacttagtcgaagcttggggctgggcggaaggtctgcaatagaacagagaagcatgtcc
attaacttgcctatgtcttgccttgattctattgcccttgggtttaactttggccggggc
catgatctttcccctctggcttctgatattctaaccaacactagcggaacgatggatgaa
ggagatgattacctgccccccaccacacctgcagtggagaagattccttgctttccaata
gagagcaaagaggaagaagataagacagagcaagcaaaagtgactggagggcaaactacc
caagttgaaacatcctccgagtcacccttcccagccaaagaatattacaaaaatggcact
gtcatggcccctgacctgcctgagatgctagatctagcagggaccaggtccagattagct
tctgtgagtgcagatgctgaggttgccaggaggaaatcagtcccatcggaggctgtggtt
gcagagagcagtactggtttgccacctgttgctgatgacagccaacccgtaaaaccagac
agtcaacttgaagacatggggtactgtgtgttcaacaagtacacagtccctctcccatcg
ccagttcaagacagtgagaatttgtcaggagagagtggttcgttttatgaaggaaccgat
gacaaagtccgtagagatttggccactgacctttcactaattgaggtaaaacttgcagct
gctggaagagtcaaagatgaattcactgctgagaaagaggcatctccaccctcttctgct
gacaaatcaggactgagtagggagtttgaccaagacaggaaagctaatgacaagctggat
actgtcctagaaaagagcgaagagcatgttgattcaaaagaacatgccaaggagtcagaa
gaggttggggataaagtagagctcttcggattaggtgtaacctatgagcaaacctctgcc
aaagaactgataacaactaaagaaacagcacctgagagagcagagaaaggtctcagttca
gtgccagaggtagctgaggtagaaacaaccacaaaagctgaccaaggtctagatgttgct
gccaagaaagatgatcagagtccattagatataaaagtcagtgactttggacagatggct
tctgggatgagtgtagatgctgggaaaaccatagagcttaagttcgaggttgatcagcag
ctgactctctcatccgaagcacctcaggaaacagattcattcatgggtattgagtccagc
cacgtgaaggatggtgccaaagtcagtgaaacagaagtcaaagagaaggtggcaaagcct
gacttggtgcatcaggaggctgtggacaaagaagagtcctatgagtctagtggtgagcat
gaaagcctcaccatggagtccctgaagcctgatgagggcaagaaagaaacatctccagag
acatcactgatacaagatgaagttgccctcaaactgtctgtagaaatcccttgcccacct
ccagtttccgaagctgattcatccattgatgagaaggcggaggtccagatggaatttatt
cagctgccaaaggaagagagcacagagactccggatatacctgccataccttctgatgtc
acccagccacagcctgaagcagttgtgtccgaaccagcagaggttcgaggtgaggaagaa
gagatcgaagctgagggagaatatgacaaactgctcttccgctcagacaccctccagatc
accgacctgcttgttccaggaagtagggaggagtttgtggagacctgcccaggggagcac
aaaggtgtggttgagtccgtggtaaccatcgaggatgatttcatcactgtagtacaaacc
acgactgatgagggagagttgggatcccacagtgtgcgctttgcagctccagttcagcct
gaggaagaaaggagaccataccctcatgatgaagagcttgaagtactgatggcagcagaa
gcccaggcagagcccaaggatggctctccagatgctccagctacccctgagaaagaagag
gttccattctcagaatataaaacagaaacctacgacgattacaaagatgagaccaccatt
gatgactccattatggatgccgacagcctgtgggtggacactcaagatgatgatagaagc
atcttgacagagcagttagaaactattcctaaagaggagagagctgagaaggaagctcgg
agaccgtctctcgagaaacatagaaaagaaaaaccttttaaaactgggagaggcagaatt
tccactcctgaaagaaaagtagctaaaaaggaacctagcacggtctccagggatgaagtg
agaaggaaaaaagcagtttataagaaggctgaacttgctaaaaaatcagaagttcaggcc
cactctccttccaggaaactcattttaaaacctgctatcaaatacactagaccaactcat
ctctcctgtgttaagcggaaaaccacagcaacaagtggtgaatcagctcaggctcccagt
gcgtttaaacaggcgaaggacaaagtcactgatggaataaccaagagcccagaaaaacgt
tcttccctcccaagaccttcctccatcctccctcctcgcaggggcgtatcaggagacagg
gaggagaactcgttctctctgaacagctccatctcttcagcacgacggaccaccaggtca
gaaccaattcgcagagcaggaaaaagcggcacctcaacacctactacccctggatctact
gcaatcacccctggcactcctccaagctactcttcacgtaccccaggcacccctggaacc
ccgagctatcccaggacaccaggaacccccaaatttggcatcttggtgcccagtgagaag
aaagttgccatcattcgcactcctccaaagtccccagctactcccaagcagcttcggctc
attaaccaacctctgccagacctgaagaacgtcaagtccaaaatcggatcaaccgacaac
atcaaataccagcctaaggggggtcaggtacaaattgttactaagaagatagacttaagc
catgtgacttccaaatgtggctctctaaagaacatccgtcacaggccaggtggtggacgc
gtgaagattgagagtgtaaagctggatttcaaggagaaggcccaagctaaagttggctca
cttgacaatgctcaccatgtacctggaggtggtaacgtgaagattgacagccaaaagctg
aacttccgagagcatgcaaaggcccgcgtcgaccacggggctgagatcatcacacagtcg
ccaagcaggtcaagcgtggcgtctccccggcgactcagcaatgtctcctcttctggaagc
atcaacctgctcgaatcccctcagctggccactttggctgaggacgtcactgcggcgctc
gctaagcagggcttgtga

DBGET integrated database retrieval system