KEGG   Rattus norvegicus (rat): 25601Help
Entry
25601             CDS       T01003                                 

Gene name
Oprm1, MORA, Oprm, Oprrm1
Definition
(RefSeq) opioid receptor, mu 1
  KO
K04215  mu-type opioid receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04080  Neuroactive ligand-receptor interaction
rno04915  Estrogen signaling pathway
rno05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    25601 (Oprm1)
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    25601 (Oprm1)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    25601 (Oprm1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    25601 (Oprm1)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Peptide
   Opioid
    25601 (Oprm1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7tm_4
Motif
Other DBs
NCBI-GeneID: 25601
NCBI-ProteinID: NP_001291664
RGD: 3234
Ensembl: ENSRNOG00000018191
Vega: OTTRNOG00000001849
UniProt: P33535
Position
1q11
AA seq 398 aa AA seqDB search
MDSSTGPGNTSDCSDPLAQASCSPAPGSWLNLSHVDGNQSDPCGLNRTGLGGNDSLCPQT
GSPSMVTAITIMALYSIVCVVGLFGNFLVMYVIVRYTKMKTATNIYIFNLALADALATST
LPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALDFRT
PRNAKIVNVCNWILSSAIGLPVMFMATTKYRQGSIDCTLTFSHPTWYWENLLKICVFIFA
FIMPVLIITVCYGLMILRLKSVRMLSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIHIYV
IIKALITIPETTFQTVSWHFCIALGYTNSCLNPVLYAFLDENFKRCFREFCIPTSSTIEQ
QNSTRVRQNTREHPSTANTVDRTNHQLENLEAETAPLP
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggacagcagcaccggcccagggaacaccagcgactgctcagaccccttagctcaggca
agttgctccccagcacctggctcctggctcaacttgtcccacgttgatggcaaccagtcc
gatccatgcggtctgaaccgcaccgggcttggcgggaacgacagcctgtgccctcagacc
ggcagcccttccatggtcacagccattaccatcatggccctctactctatcgtgtgtgta
gtgggcctcttcggaaacttcctggtcatgtatgtgattgtaagatacaccaaaatgaag
actgccaccaacatctacattttcaaccttgctctggcagacgccttagcgaccagtaca
ctgccctttcagagtgtcaactacctgatgggaacatggcccttcggaaccatcctctgc
aagatcgtgatctcaatagattactacaacatgttcaccagcatattcaccctctgcacc
atgagcgtggaccgctacattgctgtctgccacccagtcaaagccctggatttccgtacc
ccccgaaatgccaaaatcgtcaacgtctgcaactggatcctctcttctgccatcggtctg
cctgtaatgttcatggcaaccacaaaatacaggcaggggtccatagattgcaccctcacg
ttctcccacccaacctggtactgggagaacctgctcaaaatctgtgtctttatcttcgct
ttcatcatgccggtcctcatcatcactgtgtgttacggcctgatgatcttacgactcaag
agcgttcgcatgctatcgggctccaaagaaaaggacaggaatctgcgcaggatcacccgg
atggtgctggtggtcgtggctgtatttatcgtctgctggacccccatccacatctacgtc
atcatcaaagcgctgatcacgattccagaaaccacatttcagaccgtttcctggcacttc
tgcattgctttgggttacacgaacagctgcctgaatccagttctttacgccttcctggat
gaaaacttcaagcgatgcttcagagagttctgcatcccaacctcgtccacgatcgaacag
caaaactccactcgagtccgtcagaacactagggaacatccctccacggctaatacagtg
gatcgaactaaccaccagctagaaaatctggaggcagaaactgctccattgccctaa

DBGET integrated database retrieval system