KEGG   Rattus norvegicus (rat): 25610
Entry
25610             CDS       T01003                                 

Gene name
Csf3
Definition
(RefSeq) granulocyte colony-stimulating factor precursor
  KO
K05423  granulocyte colony-stimulating factor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04151  PI3K-Akt signaling pathway
rno04630  JAK-STAT signaling pathway
rno04640  Hematopoietic cell lineage
rno04657  IL-17 signaling pathway
rno05144  Malaria
rno05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    25610 (Csf3)
   04151 PI3K-Akt signaling pathway
    25610 (Csf3)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    25610 (Csf3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    25610 (Csf3)
   04657 IL-17 signaling pathway
    25610 (Csf3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    25610 (Csf3)
  09174 Infectious disease: parasitic
   05144 Malaria
    25610 (Csf3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    25610 (Csf3)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  CSF and other factors
   25610 (Csf3)
SSDB
Motif
Pfam: GCSF IL11 IL6
Other DBs
NCBI-GeneID: 25610
NCBI-ProteinID: NP_058800
RGD: 2426
Ensembl: ENSRNOG00000008525
Position
10
AA seq 199 aa
MKLMALQLLLWHSALWSGQEAIPLLTVSSLPPSLPLPRSFLLKSLEQVRKIQARNTELLE
QLCATYKLCHPEELVLFGHSLGIPKASLSSCSSQALQQTKCLSQLHSGLFLYQGLLQALA
GISSELAPTLDMLHLDVDNFATTIWQQMESLGVAPTVQPTQSTMPIFTSAFQRRAGGVLV
TSYLQSFLETAHHALHHLA
NT seq 600 nt   +upstreamnt  +downstreamnt
atgaagctgatggccctacagctgctgctgtggcacagtgcactatggtcaggacaagag
gccattcccctgctcaccgtcagctctctgccaccatccctgcctttgccccgaagcttt
ctgcttaagtccttggagcaagtgaggaagattcaggccaggaacactgaactgctggag
cagctgtgtgccacctacaagctgtgtcatccggaggagctggtgctgtttggccactct
ctgggtatccccaaggcttccctgagcagctgctccagccaggccttgcagcagacaaag
tgcctgagccaactgcacagcgggctcttcctctaccaaggtctcctgcaggccctagca
ggcatttcctctgagctggcccccaccttggatatgcttcacctggatgtcgacaacttt
gccaccaccatctggcagcagatggaaagcctcggggtggcccctactgtgcagcccacc
cagagcaccatgccaatcttcacttctgccttccagcgtcgggcaggaggagtcctggtc
acttcatacctgcagagcttcctggagacagctcaccacgctctgcaccacttggcctag

DBGET integrated database retrieval system