KEGG   Rattus norvegicus (rat): 25614Help
Entry
25614             CDS       T01003                                 

Gene name
Ptk2, FAK, FRNK, p125FAK
Definition
(RefSeq) protein tyrosine kinase 2
  KO
K05725  focal adhesion kinase 1 [EC:2.7.10.2]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01522  Endocrine resistance
rno04012  ErbB signaling pathway
rno04062  Chemokine signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04360  Axon guidance
rno04370  VEGF signaling pathway
rno04510  Focal adhesion
rno04670  Leukocyte transendothelial migration
rno04810  Regulation of actin cytoskeleton
rno04935  Growth hormone synthesis, secretion and action
rno05100  Bacterial invasion of epithelial cells
rno05135  Yersinia infection
rno05146  Amoebiasis
rno05163  Human cytomegalovirus infection
rno05165  Human papillomavirus infection
rno05170  Human immunodeficiency virus 1 infection
rno05200  Pathways in cancer
rno05202  Transcriptional misregulation in cancer
rno05205  Proteoglycans in cancer
rno05222  Small cell lung cancer
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    25614 (Ptk2)
   04370 VEGF signaling pathway
    25614 (Ptk2)
   04151 PI3K-Akt signaling pathway
    25614 (Ptk2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    25614 (Ptk2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    25614 (Ptk2)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    25614 (Ptk2)
   04062 Chemokine signaling pathway
    25614 (Ptk2)
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    25614 (Ptk2)
  09158 Development and regeneration
   04360 Axon guidance
    25614 (Ptk2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    25614 (Ptk2)
   05202 Transcriptional misregulation in cancer
    25614 (Ptk2)
   05205 Proteoglycans in cancer
    25614 (Ptk2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    25614 (Ptk2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    25614 (Ptk2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    25614 (Ptk2)
   05100 Bacterial invasion of epithelial cells
    25614 (Ptk2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    25614 (Ptk2)
   05163 Human cytomegalovirus infection
    25614 (Ptk2)
   05165 Human papillomavirus infection
    25614 (Ptk2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    25614 (Ptk2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    25614 (Ptk2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    25614 (Ptk2)
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    25614 (Ptk2)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     25614 (Ptk2)
Protein kinases [BR:rno01001]
 Non-receptor tyrosine kinases
  FAK family
   25614 (Ptk2)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     25614 (Ptk2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Focal_AT Pkinase FERM_N_2 FERM_M Haspin_kinase FERM_F2 Kinase-like
Motif
Other DBs
NCBI-GeneID: 25614
NCBI-ProteinID: NP_037213
RGD: 3443
Ensembl: ENSRNOG00000007916
UniProt: O35346
Position
7q34
AA seq 1055 aa AA seqDB search
MAAAYLDPNLNHTPSSSTKTHLGTGTERSPGAMERVLKVFHYFESSNEPTTWASIIRHGD
ATDVRGIIQKIVDSHKVKHVACYGFRLSHLRSEEVHWLHVDMGVSSVREKYELAHPPEEW
KYELRIRYLPKGFLNQFTEDKPTLNFFYQQVKSDYMLEIADQVDQDIALKLGCLEIRRSY
WEMRGNALEKKSNYEVLEKDVGLKRFFPKSLLDSVKAKTLRKLIQQTFRQFANLNREESI
LKFFEILSPVYRFDKECFKCALGSSWIISVELAIGPEEGISYLTDKGCNPTHLADFNQVQ
TIQYSNSEDKDRKGMLQLKIAGAPEPLTVTAPSLTIAENMADLIDGYCRLVNGATQSFII
RPQKEGERALPSIPKLANNEKQGMRTHAVSVSETDDYAEIIDEEDTYTMPSTRDYEIQRE
RIELGRCIGEGQFGDVHQGVYLSPENPALAVAIKTCKNCTSDSVREKFLQEALTMRQFDH
PHIVKLIGVITENPVWIIMELCTLGELRSFLQVRKYSLDLASLILYAYQLSTALAYLESK
RFVHRDIAARNVLVSSNDCVKLGDFGLSRYMEDSTYYKASKGKLPIKWMAPESINFRRFT
SASDVWMFGVCMWEILMHGVKPFQGVKNNDVIGRIENGERLPMPPNCPPTLYSLMTKCWA
YDPSRRPRFTELKAQLSTILEEEKVQQEERMRMESRRQATVSWDSGGSDEAPPKPSRPGY
PSPRSSEGFYPSPQHMVQTNHYQISGYPGSHGIPAMAGSIYPGQASLLDQTELWNHRPQE
MSMWQPSVEDSAALDLRGMGQVLPPHLMEERLIRQQQEMEEDQRWLEKEERFLKPDVRLS
RGSIDREDGSFQGPTGNQHIYQPVGKPDPAAPPKKPPRPGAPGHLSNLSSISSPAESYNE
GVKPWRLQPQEISPPPTANLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEV
GLALRTLLATVDETIPILPASTHREIEMAQKLLNSDLGELISKMKLAQQYVMTSLQQEYK
KQMLTAAHALAVDAKNLLDVIDQARLKMLGQTRPH
NT seq 3168 nt NT seq  +upstreamnt  +downstreamnt
atggcagctgcttatcttgacccaaacttgaatcacacaccaagttcgagtactaagact
cacctgggtactggcacggaacggtcccctggtgcaatggaacgagtattaaaggtcttt
cattattttgaaagcagtaatgagccaaccacctgggccagtattatcaggcatggagac
gctactgacgtcaggggaatcattcagaagatagtggacagtcacaaagtaaagcacgtg
gcctgctatggatttcgcctcagtcacctgcgatcggaggaggtgcactggctgcatgtg
gacatgggtgtctccagtgtgagggagaaatacgaactcgcccacccaccagaggagtgg
aaatatgagttgagaattcgttatttgccaaaaggatttctaaaccagtttactgaagat
aagccaacattgaatttcttctatcaacaggtgaagagtgactacatgctagaaatagct
gatcaagtagaccaagacatagctttgaagttgggttgtttggaaattaggcgatcctac
tgggagatgaggggcaacgccctagagaagaagtccaactatgaagtgttagagaaagat
gttggtttaaagcgattttttcccaagagtttactggattccgtcaaggccaaaacacta
agaaagctgatccagcaaacattcaggcagtttgccaaccttaatagagaagaaagcatc
ctgaaattctttgagattctctctccagtgtacagatttgacaaagagtgcttcaagtgt
gcccttgggtcaagttggattatttctgtggaactggcgatcggcccagaagaagggatc
agttacctgacagacaagggctgcaatcccacacacctagcggacttcaaccaagtgcag
actatccagtactcaaacagtgaagacaaagacaggaaaggaatgctacaactcaaaatc
gctggtgctcctgagcctctgacagtgacggccccatccctaaccattgcagagaacatg
gctgacctgatcgatggatactgccggctggtgaacggagccacgcagtccttcatcatc
agaccccagaaagaaggtgaacgggcattgccatcaataccaaagttggccaacaatgaa
aagcaaggcatgcggacacatgcagtctctgtgtcagagacagatgactatgccgagatc
atcgatgaggaagacacatacaccatgccctcaaccagggattatgagattcagagagaa
agaatagaacttggacgctgtattggagaaggccagtttggagatgtacatcaaggcgtg
tacctgagcccagagaatccagctttggctgttgcaatcaaaacatgtaaaaactgtact
tcggacagcgtgagagagaagttccttcaagaagccttaacaatgcgccagtttgaccat
cctcacatcgtgaagctgattggagtcattacagagaacccagtttggataatcatggag
ttgtgcacacttggagagctgaggtcatttttgcaagtaaggaaatacagcttggatcta
gcatctttgatcttatatgcctatcagcttagtacagcactcgcgtatctggagagcaaa
agatttgttcacagggacattgctgcacggaatgttctggtgtcttcaaatgattgtgta
aaattaggagactttggattatctcgatatatggaagacagtacttactataaagcttcc
aaaggaaaattacctattaaatggatggctccagagtcaatcaattttcgacgttttacc
tcagctagtgacgtgtggatgtttggtgtgtgtatgtgggagatactgatgcatggcgtg
aagccttttcaaggagtgaagaacaatgatgtgatcggtcgaattgaaaatggggaaaga
ttaccaatgcctccaaattgtcctcccaccctctacagccttatgacgaaatgttgggcc
tatgaccccagcagacggcccaggtttactgaactaaaagctcagctcagcacaatcctg
gaggaagagaaggtgcagcaagaagaacggatgaggatggaatccagaagacaggcaaca
gtgtcctgggactctggagggtctgatgaagcaccacccaagcccagcagacctggttat
cctagcccgaggtccagtgaaggattttatcccagcccacagcacatggtccagaccaat
cactatcagatctctggctacccaggttcccatggaatcccagccatggctggcagcatt
tacccaggtcaggcatctcttctggaccagacagaattgtggaatcacagacctcaggag
atgtccatgtggcagcccagtgtggaggactcagcagctttagatcttcgagggatggga
caggtgcttcctcctcacctgatggaagagcggctaatccgacagcagcaggaaatggag
gaagaccagcgctggctggaaaaggaagagcgattcctgaaacctgatgtgaggctctct
cgaggcagcatcgacagggaggacgggagttttcagggtccgactggaaaccaacacatc
tatcagcctgtgggaaaaccagatcctgcagctccaccaaagaaaccacctcgccctgga
gcacctggccacctaagcaacttgtccagcatcagcagccctgcagaaagctacaatgag
ggtgtcaagccgtggaggcttcagccccaggaaatcagcccccctcccactgccaacctt
gaccgatccaatgacaaggtatatgaaaatgtgacgggcctagtgaaggctgtcattgag
atgtccagcaaaatccaaccagctcctccagaagagtacgtccctatggtgaaggaagtt
ggcctggccctgcggaccttactggccactgtggatgagaccattcccatccttccagcc
agcacccatcgagagatcgagatggcacagaagctgctgaactccgacttgggtgagctc
atcagcaagatgaagctggcgcagcagtatgtcatgaccagccttcagcaggagtacaag
aagcagatgctgacagctgctcacgccctggctgtggatgccaagaatctacttgatgtt
attgatcaagcgagactgaaaatgctagggcagacacggccacactga

DBGET integrated database retrieval system