KEGG   Rattus norvegicus (rat): 25615Help
Entry
25615             CDS       T01003                                 

Gene name
Sdc2, HSPG
Definition
(RefSeq) syndecan 2
  KO
K16336  syndecan 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04514  Cell adhesion molecules (CAMs)
rno05144  Malaria
rno05205  Proteoglycans in cancer
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    25615 (Sdc2)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    25615 (Sdc2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    25615 (Sdc2)
  09174 Infectious disease: parasitic
   05144 Malaria
    25615 (Sdc2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:rno04090]
    25615 (Sdc2)
   00535 Proteoglycans [BR:rno00535]
    25615 (Sdc2)
CD molecules [BR:rno04090]
 Proteins
  25615 (Sdc2)
Proteoglycans [BR:rno00535]
 Cell surface proteoglycans
  Syndecan family (transmembrane HSPG)
   25615 (Sdc2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Syndecan Glycophorin_A DUF2721 DUF5305 DUF4407 DUF2407_C MtrF
Motif
Other DBs
NCBI-GeneID: 25615
NCBI-ProteinID: NP_037214
RGD: 3649
Ensembl: ENSRNOG00000004936
UniProt: P34900 Q6IRK3
Position
7q22
AA seq 211 aa AA seqDB search
MRVRATSPGNMQRAWILLTLGLMACVSAETRAELTSDKDMYLDSSSIEEASGLYPIDDDD
YSSASGSGAYEDKGSPDLTTSQLIPRISLTSAAPEVETMTLKTQSITPTQTESPEETDKK
EFEISEAEEKQDPAVKSTDVYTEKHSDNLFKRTEVLAAVIAGGVIGFLFAIFLILLLVYR
MRKKDEGSYDLGERKPSSAAYQKAPTKEFYA
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgcgggtacgagccacgtccccggggaatatgcagcgtgcgtggatcctgctcaccttg
ggcttgatggcctgtgtgtcggcagagacgagagcagagctgacatctgataaggacatg
taccttgacagcagctccattgaggaagcttcaggattatatcctattgatgatgatgac
tattcttctgcctctggctcaggagcttatgaagacaaagggagtccagatctgacaaca
tcccaactgattccaaggatctccctcactagtgctgctcccgaagtggaaaccatgacg
ttgaagacacaaagcatcacacccactcagaccgagtcacccgaagaaactgacaagaag
gagtttgaaatctctgaggcagaagaaaagcaggaccctgctgtaaaaagcacagacgtg
tacaccgagaaacattcagacaatctgttcaagcggacggaagttctagcagctgtcatt
gctggcggtgtgattggctttctctttgccattttcctcatcctgttgttggtgtaccgc
atgcggaagaaagacgaaggaagctacgaccttggagaacgcaaaccgtccagcgcagct
taccagaaggcacccactaaggagttttatgcataa

DBGET integrated database retrieval system