KEGG   Rattus norvegicus (rat): 25617
Entry
25617             CDS       T01003                                 

Gene name
Hspa5
Definition
(RefSeq) endoplasmic reticulum chaperone BiP precursor
  KO
K09490  endoplasmic reticulum chaperone BiP [EC:3.6.4.10]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03060  Protein export
rno04141  Protein processing in endoplasmic reticulum
rno04612  Antigen processing and presentation
rno04918  Thyroid hormone synthesis
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    25617 (Hspa5)
   04141 Protein processing in endoplasmic reticulum
    25617 (Hspa5)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    25617 (Hspa5)
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    25617 (Hspa5)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    25617 (Hspa5)
   05014 Amyotrophic lateral sclerosis
    25617 (Hspa5)
   05020 Prion disease
    25617 (Hspa5)
   05022 Pathways of neurodegeneration - multiple diseases
    25617 (Hspa5)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    25617 (Hspa5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:rno03110]
    25617 (Hspa5)
   04131 Membrane trafficking [BR:rno04131]
    25617 (Hspa5)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    25617 (Hspa5)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.10  non-chaperonin molecular chaperone ATPase
     25617 (Hspa5)
Chaperones and folding catalysts [BR:rno03110]
 Heat shock proteins
  HSP70 / DNAK
   25617 (Hspa5)
Membrane trafficking [BR:rno04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   ER-Golgi intermediate compartment (ERGIC) proteins
    25617 (Hspa5)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   25617 (Hspa5)
  Exosomal proteins of other body fluids (saliva and urine)
   25617 (Hspa5)
  Exosomal proteins of colorectal cancer cells
   25617 (Hspa5)
SSDB
Motif
Pfam: HSP70 MreB_Mbl FtsA Hydantoinase_A FGGY_C DDR DUF4795 RNB
Other DBs
NCBI-GeneID: 25617
NCBI-ProteinID: NP_037215
RGD: 2843
Ensembl: ENSRNOG00000018294
UniProt: P06761
Position
3
AA seq 654 aa
MKFTVVAAALLLLCAVRAEEEDKKEDVGTVVGIDLGTTYSCVGVFKNGRVEIIANDQGNR
ITPSYVAFTPEGERLIGDAAKNQLTSNPENTVFDAKRLIGRTWNDPSVQQDIKFLPFKVV
EKKTKPYIQVDIGGGQTKTFAPEEISAMVLTKMKETAEAYLGKKVTHAVVTVPAYFNDAQ
RQATKDAGTIAGLNVMRIINEPTAAAIAYGLDKREGEKNILVFDLGGGTFDVSLLTIDNG
VFEVVATNGDTHLGGEDFDQRVMEHFIKLYKKKTGKDVRKDNRAVQKLRREVEKAKRALS
SQHQARIEIESFFEGEDFSETLTRAKFEELNMDLFRSTMKPVQKVLEDSDLKKSDIDEIV
LVGGSTRIPKIQQLVKEFFNGKEPSRGINPDEAVAYGAAVQAGVLSGDQDTGDLVLLDVC
PLTLGIETVGGVMTKLIPRNTVVPTKKSQIFSTASDNQPTVTIKVYEGERPLTKDNHLLG
TFDLTGIPPAPRGVPQIEVTFEIDVNGILRVTAEDKGTGNKNKITITNDQNRLTPEEIER
MVNDAEKFAEEDKKLKERIDTRNELESYAYSLKNQIGDKEKLGGKLSPEDKETMEKAVEE
KIEWLESHQDADIEDFKAKKKELEEIVQPIISKLYGSGGPPPTGEEDTSEKDEL
NT seq 1965 nt   +upstreamnt  +downstreamnt
atgaagttcactgtggtggcggcggcgctgctgctgctgtgtgcggtgcgggcggaggag
gaggacaagaaggaggatgtaggcacggtggttggcatcgacttggggaccacctattcc
tgcgtcggtgtattcaagaacggccgcgtggagatcatagccaacgatcagggcaaccgc
atcacaccgtcgtatgtggccttcactcctgaaggggagcgtctgattggcgatgcggcc
aagaaccaactcacgtccaacccggagaacaccgtcttcgacgccaagcgcctcatcgga
cgcacttggaatgacccttccgtgcagcaggacatcaagttcttgccattcaaggtggtt
gaaaagaaaactaaaccatatattcaagttgatatcggaggtgggcaaaccaagacattt
gccccagaagaaatttctgctatggttctcactaaaatgaaggaaactgccgaggcgtat
ttgggaaagaaggtcacccatgcagttgtgactgtaccagcttacttcaatgatgcacag
cggcaagcaaccaaggatgctggcactattgctggactgaatgtcatgaggatcatcaat
gagccaacagcagctgctattgcatatggcctggataagagagagggagagaagaacatc
ctcgtgtttgacctgggtggtggaaccttcgatgtgtctcttctcaccattgacaatggt
gtctttgaagtggtggccactaatggagacactcatctgggtggggaagactttgatcag
cgggtcatggagcacttcatcaagctgtacaaaaagaagactgggaaagatgtcagaaag
gacaacagagctgtgcagaaactccggcgtgaggtagaaaaggccaagagagccctgtct
tctcagcatcaagcgaggattgaaattgagtccttcttcgaaggagaagacttctcagag
acccttactcgggccaaatttgaagagctgaacatggacctgttccgctctaccatgaaa
cctgtccagaaagtgttggaagactctgatctgaagaaatctgatattgatgagattgtt
ctggttggcggatctactcgaattccaaagattcagcagttggtgaaagagttcttcaat
ggcaaggagccgtcccgtggcatcaacccagatgaggctgtagcatatggtgccgctgtc
caggctggtgtcctctctggtgatcaagatacaggtgacctggttctgcttgatgtgtgt
cctcttacacttggtattgaaactgtgggaggtgtcatgacaaaactgattccgaggaac
actgtggtgcccaccaagaagtctcagatcttctccacagcttctgataatcagcccacc
gtaacaatcaaggtctacgaaggtgaacgacccctgacaaaagacaatcaccttctgggt
acatttgatctgactggaatccctcctgctccccgtggggtaccccagattgaagtcacc
tttgagatagatgtgaatggtattcttcgagtgacagctgaagacaaagggacaggaaac
aaaaacaaaatcaccatcaccaatgaccaaaaccgcctgacccctgaagaaattgaaagg
atggtcaatgacgccgagaagtttgctgaggaagacaaaaagctcaaagagcgcattgac
acgaggaatgaattggaaagctatgcttactctcttaagaaccagatcggagataaagag
aagctgggaggtaagctgtctcctgaagataaagagaccatggagaaagctgtagaggaa
aagatcgaatggctggaaagccaccaggatgcagacattgaagactttaaagctaaaaag
aaggaactagaagaaattgttcagccaattatcagcaaactctatggaagtggaggccct
cccccaactggtgaagaggatacatcagaaaaagatgagttgtag

DBGET integrated database retrieval system