KEGG   Rattus norvegicus (rat): 25619
Entry
25619             CDS       T01003                                 

Gene name
Plau, UPAM
Definition
(RefSeq) plasminogen activator, urokinase
  KO
K01348  urokinase plasminogen activator [EC:3.4.21.73]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04064  NF-kappa B signaling pathway
rno04610  Complement and coagulation cascades
rno05202  Transcriptional misregulation in cancer
rno05205  Proteoglycans in cancer
rno05206  MicroRNAs in cancer
rno05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    25619 (Plau)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    25619 (Plau)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    25619 (Plau)
   05206 MicroRNAs in cancer
    25619 (Plau)
   05205 Proteoglycans in cancer
    25619 (Plau)
  09162 Cancer: specific types
   05215 Prostate cancer
    25619 (Plau)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    25619 (Plau)
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    25619 (Plau)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.73  u-plasminogen activator
     25619 (Plau)
Peptidases and inhibitors [BR:rno01002]
 Serine peptidases
  Family S1: chymotrypsin family
   25619 (Plau)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Haparin
  Coagulation and fibrinolysis
   25619 (Plau)
SSDB
Motif
Pfam: Trypsin Kringle DUF316 Prokineticin Trypsin_2
Other DBs
NCBI-GeneID: 25619
NCBI-ProteinID: NP_037217
RGD: 3343
Ensembl: ENSRNOG00000010516
UniProt: Q3KR76
Position
15p16
AA seq 432 aa
MRVWLASLFLCALVAHSEGGSELGASDESNCGCQNGGVCVSYKYFSSIRRCSCPKKFKGE
HCEIDTSKTCYHGNGQSYRGKANTDTKGRPCLAWNSPAVLQQTYNAHRSDALSLGLGKHN
YCRNPDNQRRPWCYVQIGLKQFVQECMVQDCSLSKKPSSTVDQQGFQCGQKALRPRFKIV
GGEFTVVENQPWFAAIYLKNKGGSPPSFKCGGSLISPCWVASATHCFVNQPKKEEYVVYL
GQSKRNSYNPGEMKFEVEQLILHEDFSDETLAFHNDIALLKIRTSTGQCAQPSRTIQTIC
LPPRFGDAPFGSDCEITGFGQESATDYFYPKDLKMSVVKIISHEQCKQPHYYGSEINYKM
LCAADPEWKTDSCSGDSGGPLICNIDGRPTLSGIVSWGSGCAEKNKPGVYTRVSYFLNWI
QSHIGEENGLAF
NT seq 1299 nt   +upstreamnt  +downstreamnt
atgagagtctggcttgcgagcctgttcctctgcgccttggtggcgcactctgaaggtggc
agtgaacttggagcttctgatgaatcaaactgtggctgtcagaacggaggagtatgtgtg
tcctacaagtacttctccagcattcgaagatgcagctgcccaaagaaattcaaaggggag
cactgtgagatagatacatcaaaaacctgctatcatggaaatggtcaatcttaccgagga
aaggccaatactgacaccaaaggccggccctgcctggcctggaattcacccgctgtcctt
cagcaaacctacaatgctcacagatccgatgctcttagcctaggcctggggaaacacaat
tactgcaggaaccccgacaaccagaggcgaccctggtgctatgtgcaaattggcctaaag
cagtttgtccaagaatgcatggtgcaggactgctctctcagcaaaaagccttcttctact
gtagaccaacaagggttccagtgtggccagaaggctctaaggccccgcttcaagatcgtt
gggggagaattcactgtcgttgagaaccagccctggtttgcagccatctacctgaagaat
aagggaggaagccctccctcctttaaatgtggtgggagcctcatcagtccttgctgggtg
gccagcgccacacactgcttcgtgaatcagccaaagaaggaagagtacgttgtctacctg
ggtcagtcgaagcggaactcctataaccccggagagatgaagtttgaggtggagcagctc
atcttgcacgaagacttcagcgacgaaactctggccttccataatgacatagccttgctg
aagatacgtaccagcacgggccaatgcgcacagccatccaggaccatacagaccatctgc
ctgcccccgaggtttggtgatgctccgtttggttcagactgtgagatcactggcttcgga
caagagagtgccactgactatttctatccgaaggacctgaaaatgtcagttgtaaagatt
atttctcacgaacagtgcaagcagcctcactactatggctctgaaattaattataaaatg
ctgtgtgctgctgacccagagtggaaaacagattcctgctcgggagattcaggaggacct
cttatctgtaacatcgatggccgcccaactctgagcgggattgtgagctggggcagtgga
tgtgcagagaaaaacaagcctggtgtctacacgagggtctcatacttcctgaactggatt
cagtcccacattggagaagagaatggcctagccttctga

DBGET integrated database retrieval system