KEGG   Rattus norvegicus (rat): 25622Help
Entry
25622             CDS       T01003                                 

Gene name
Ptpn11, Shp2
Definition
(RefSeq) protein tyrosine phosphatase, non-receptor type 11
  KO
K07293  tyrosine-protein phosphatase non-receptor type 11 [EC:3.1.3.48]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04014  Ras signaling pathway
rno04072  Phospholipase D signaling pathway
rno04360  Axon guidance
rno04625  C-type lectin receptor signaling pathway
rno04630  Jak-STAT signaling pathway
rno04650  Natural killer cell mediated cytotoxicity
rno04670  Leukocyte transendothelial migration
rno04722  Neurotrophin signaling pathway
rno04920  Adipocytokine signaling pathway
rno04931  Insulin resistance
rno05168  Herpes simplex virus 1 infection
rno05205  Proteoglycans in cancer
rno05211  Renal cell carcinoma
rno05220  Chronic myeloid leukemia
rno05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    25622 (Ptpn11)
   04630 Jak-STAT signaling pathway
    25622 (Ptpn11)
   04072 Phospholipase D signaling pathway
    25622 (Ptpn11)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    25622 (Ptpn11)
   04650 Natural killer cell mediated cytotoxicity
    25622 (Ptpn11)
   04670 Leukocyte transendothelial migration
    25622 (Ptpn11)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    25622 (Ptpn11)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    25622 (Ptpn11)
  09158 Development
   04360 Axon guidance
    25622 (Ptpn11)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    25622 (Ptpn11)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    25622 (Ptpn11)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    25622 (Ptpn11)
   05211 Renal cell carcinoma
    25622 (Ptpn11)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    25622 (Ptpn11)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    25622 (Ptpn11)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    25622 (Ptpn11)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     25622 (Ptpn11)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Non-receptor PTPs
    25622 (Ptpn11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Y_phosphatase SH2 DSPc Y_phosphatase3 PTPlike_phytase Tab2_like
Motif
Other DBs
NCBI-GeneID: 25622
NCBI-ProteinID: NP_001171064
RGD: 3447
Ensembl: ENSRNOG00000030124
UniProt: P41499
Position
12q16
AA seq 597 aa AA seqDB search
MTSRRWFHPNITGVEAENLLLTRGVDGSFLARPSKSNPGDFTLSVRRNGAVTHIKIQNTG
DYYDLYGGEKFATLAELVQYYMEHHGQLKEKNGDVIELKYPLNCADPTSERWFHGHLSGK
EAEKLLTEKGKHGSFLVRESQSHPGDFVLSVRTGDDKGESNDSKSKVTHVMIRCQELKYD
VGGGERFDSLTDLVEHYKKNPMVETLGTVLQLKQPLNTTRINAAEIESRVRELSKLAETT
DKVKQGFWEEFETLQQQECKLLYSRKEGQRQENKNKNRYKNILPFDHTRVVLHDGDPNEP
VSDYINANIIMPEFETKCNNSKPKKSYIATQGCLQNTVNDFWRMVFQENSRVIVMTTKEV
ERGKSKCVKYWPDECALKEYGVMRVRNVRESAAHDYTLRELKLSKVGQALLQGNTERTVW
QYHFRTWPDHGVPSDPGGVLDFLEEVHHKQESIVDAGPVVVHCSAGIGRTGTFIVIDILI
DIIREKGVDCDIDVPKTIQMVRSQRSGMVQTEAQYRFIYMAVQHYIETLQRRIEEEQKSK
RKGHEYTNIKYSLVDQTSGDQSPLPPCTPTPPCAEMREDSARVYENVGLMQQQRSFR
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atgacatcccggagatggtttcaccccaatatcactggtgtggaggcagagaatctcctg
ctgacccgaggagtcgatggcagtttcttagcgaggcccagcaagagtaaccctggagac
ttcactctgtctgttagaagaaatggagccgttacccacatcaagattcagaacactggg
gactactatgacctctatggcggggaaaagtttgccaccttggctgaactggtccagtat
tacatggagcatcacgggcagctgaaagagaagaatggagatgttattgagctcaagtac
ccactgaactgtgcagaccctacctctgaaaggtggttccacggtcacttgtctggaaaa
gaagcagagaagctgctgacagagaaggggaagcatggcagtttcctcgtccgggagagc
cagagccaccctggggacttcgtcctctccgtccgcactggtgatgacaaaggggagagc
aatgacagcaagtccaaagtgacccatgtcatgatccgctgtcaggagctgaaatatgat
gttggtggaggagagcgctttgactctttgacagacctggtggagcattacaagaagaac
cccatggtggagacactgggcacagtcctgcagctcaaacagcccctcaacacaactcgt
attaatgccgctgaaatcgaaagccgggttcgggagttaagcaagctagccgagaccaca
gataaagtcaaacagggcttttgggaagaatttgagactctacagcaacaggaatgcaaa
cttctctacagccgaaaagaaggacagagacaagaaaataaaaacaaaaatagatacaaa
aacatcctgccctttgatcataccagggttgtcctgcacgatggggatcccaacgagcca
gtttctgattacatcaatgccaacatcatcatgcctgaatttgaaaccaagtgcaacaat
tcaaaacccaaaaagagttacattgccactcaaggctgcctgcagaacacggtgaatgac
ttctggcggatggtgttccaggagaactctcgagtcattgtcatgaccacaaaggaagtg
gagagagggaagagcaagtgtgtcaagtactggcctgatgagtgtgcactcaaagagtat
ggcgtcatgcgtgtgaggaacgtcagagaaagtgctgcgcatgactacaccttacgagaa
ctcaaactctctaaggtcggacaagctctactccagggaaacacagagagaaccgtctgg
cagtaccactttcggacctggccagaccacggtgtgcctagtgaccctggaggtgtgctg
gacttcctggaggaggtccaccacaagcaggagagcatcgtggatgcaggccctgtcgtg
gttcactgcagtgctgggattggccggacaggaacgttcattgtgattgatatccttatt
gacatcatccgagagaaaggtgtggactgtgacatcgacgttcctaaaaccattcagatg
gtacggtcccagaggtcagggatggtccagacagaagcacagtaccggttcatctacatg
gccgtccagcactacatagagacgctgcaacgcaggatcgaggaggagcagaaaagcaaa
aggaaaggacatgaatataccaatattaagtattccctggtggaccagacaagtggcgat
cagagtcccctgccaccttgcaccccaacgccaccctgtgcggaaatgcgggaggacagc
gctcgagtctatgagaacgtgggcctcatgcagcagcagaggagtttcagatga

DBGET integrated database retrieval system