KEGG   Rattus norvegicus (rat): 25625Help
Entry
25625             CDS       T01003                                 

Gene name
Tnfrsf1a, TNFR-1, Tnfr1
Definition
(RefSeq) TNF receptor superfamily member 1A
  KO
K03158  tumor necrosis factor receptor superfamily member 1A
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04060  Cytokine-cytokine receptor interaction
rno04064  NF-kappa B signaling pathway
rno04071  Sphingolipid signaling pathway
rno04150  mTOR signaling pathway
rno04210  Apoptosis
rno04215  Apoptosis - multiple species
rno04217  Necroptosis
rno04380  Osteoclast differentiation
rno04668  TNF signaling pathway
rno04920  Adipocytokine signaling pathway
rno04931  Insulin resistance
rno04932  Non-alcoholic fatty liver disease (NAFLD)
rno05010  Alzheimer disease
rno05014  Amyotrophic lateral sclerosis (ALS)
rno05142  Chagas disease (American trypanosomiasis)
rno05145  Toxoplasmosis
rno05152  Tuberculosis
rno05160  Hepatitis C
rno05163  Human cytomegalovirus infection
rno05164  Influenza A
rno05165  Human papillomavirus infection
rno05166  Human T-cell leukemia virus 1 infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05168  Herpes simplex infection
rno05170  Human immunodeficiency virus 1 infection
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    25625 (Tnfrsf1a)
   04064 NF-kappa B signaling pathway
    25625 (Tnfrsf1a)
   04668 TNF signaling pathway
    25625 (Tnfrsf1a)
   04071 Sphingolipid signaling pathway
    25625 (Tnfrsf1a)
   04150 mTOR signaling pathway
    25625 (Tnfrsf1a)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    25625 (Tnfrsf1a)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    25625 (Tnfrsf1a)
   04215 Apoptosis - multiple species
    25625 (Tnfrsf1a)
   04217 Necroptosis
    25625 (Tnfrsf1a)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    25625 (Tnfrsf1a)
  09158 Development
   04380 Osteoclast differentiation
    25625 (Tnfrsf1a)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05010 Alzheimer disease
    25625 (Tnfrsf1a)
   05014 Amyotrophic lateral sclerosis (ALS)
    25625 (Tnfrsf1a)
  09166 Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    25625 (Tnfrsf1a)
  09167 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    25625 (Tnfrsf1a)
   04931 Insulin resistance
    25625 (Tnfrsf1a)
  09171 Infectious diseases: Bacterial
   05152 Tuberculosis
    25625 (Tnfrsf1a)
  09172 Infectious diseases: Viral
   05166 Human T-cell leukemia virus 1 infection
    25625 (Tnfrsf1a)
   05170 Human immunodeficiency virus 1 infection
    25625 (Tnfrsf1a)
   05164 Influenza A
    25625 (Tnfrsf1a)
   05160 Hepatitis C
    25625 (Tnfrsf1a)
   05168 Herpes simplex infection
    25625 (Tnfrsf1a)
   05163 Human cytomegalovirus infection
    25625 (Tnfrsf1a)
   05167 Kaposi sarcoma-associated herpesvirus infection
    25625 (Tnfrsf1a)
   05165 Human papillomavirus infection
    25625 (Tnfrsf1a)
  09174 Infectious diseases: Parasitic
   05145 Toxoplasmosis
    25625 (Tnfrsf1a)
   05142 Chagas disease (American trypanosomiasis)
    25625 (Tnfrsf1a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:rno04050]
    25625 (Tnfrsf1a)
   04090 CD molecules [BR:rno04090]
    25625 (Tnfrsf1a)
Cytokine receptors [BR:rno04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   25625 (Tnfrsf1a)
CD molecules [BR:rno04090]
 Proteins
  25625 (Tnfrsf1a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNFR_c6 Death DUF4880
Motif
Other DBs
NCBI-GeneID: 25625
NCBI-ProteinID: NP_037223
RGD: 621237
Ensembl: ENSRNOG00000031312
UniProt: P22934
Position
4q42
AA seq 461 aa AA seqDB search
MGLPIVPGLLLSLVLLALLMGIHPSGVTGLVPSLGDREKRDNLCPQGKYAHPKNNSICCT
KCHKGTYLVSDCPSPGQETVCEVCDKGTFTASQNHVRQCLSCKTCRKEMFQVEISPCKAD
MDTVCGCKKNQFQRYLSETHFQCVDCSPCFNGTVTIPCKEKQNTVCNCHAGFFLSGNECT
PCSHCKKNQECMKLCLPPVANVTNPQDSGTAVLLPLVIFLGLCLLFFICISLLCRYPQWR
PRVYSIICRDSAPVKEVEGEGIVTKPLTPASIPAFSPNPGFNPTLGFSTTPRFSHPVSST
PISPVFGPSNWHNFVPPVREVVPTQGADPLLYGSLNPVPIPAPVRKWEDVVAAQPQRLDT
ADPAMLYAVVDGVPPTRWKEFMRLLGLSEHEIERLELQNGRCLREAHYSMLEAWRRRTPR
HEATLDVVGRVLCDMNLRGCLENIRETLESPAHSSTTHLPR
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgggtctccccatcgtgcctggcctgctgctgtcactggtgctcctggctctgctgatg
gggatacacccatcaggggtcaccggactggttccttctcttggtgaccgggagaagagg
gataatttgtgtccccagggaaagtatgcccatccaaagaataattccatctgctgcacc
aagtgccacaaaggaacctacttggtgagtgactgtccaagcccagggcaggaaacagtc
tgcgaggtgtgtgataaaggcacctttacagcttcgcagaaccacgtcagacagtgtctc
agttgcaagacatgtcggaaagaaatgttccaggtggagatttctccttgcaaagctgac
atggacaccgtgtgtggctgcaagaagaaccaattccagcgctacctgagtgagacgcat
ttccagtgtgtggactgcagcccctgcttcaatggcaccgtgacaatcccctgtaaggag
aaacagaacaccgtgtgtaactgccacgcaggattctttctaagcggaaatgagtgcacc
ccttgcagccactgcaagaaaaatcaggaatgtatgaagctgtgcctacctccagttgca
aatgtcacaaacccccaggactcaggtactgccgtgctgttgcctctggttatcttccta
ggtctttgccttttattctttatctgcatcagtctactgtgccgatatccccagtggagg
cccagggtctactccatcatttgtagggattcagctcctgtcaaagaggtggagggtgaa
ggaattgttactaagcccctaactccagcctctatcccagccttcagccccaaccccggc
ttcaaccccactctgggcttcagcaccaccccacgcttcagtcatcctgtctccagtacc
cccatcagccccgtcttcggtcctagtaactggcacaacttcgtgccacctgtaagagag
gtggtcccaacccagggtgctgaccctctcctctacggatccctcaaccctgtgccaatc
cccgcccctgttcggaaatgggaagacgtcgtcgcggcccagccacaacggcttgacact
gcagaccctgcgatgctgtatgctgtggtggatggcgtgcctccgacacgctggaaggag
ttcatgcggctcctggggctgagcgagcacgagatcgagcggctggagctgcagaacggg
cgttgcctccgcgaggctcattacagcatgctggaagcctggcggcgccgcacaccgcga
cacgaggccacgctggacgtagtgggccgcgtgctttgcgacatgaacctgcgtggctgc
ctggagaacatccgcgagactctagaaagccctgcccactcgtccacgacccacctcccg
cgataa

DBGET integrated database retrieval system