KEGG   Rattus norvegicus (rat): 25626Help
Entry
25626             CDS       T01003                                 

Gene name
Krt8, CYKER, Krt2-8
Definition
(RefSeq) keratin 8
  KO
K07605  type II keratin, basic
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    25626 (Krt8)
   04147 Exosome [BR:rno04147]
    25626 (Krt8)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     25626 (Krt8)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   25626 (Krt8)
  Exosomal proteins of other body fluids (saliva and urine)
   25626 (Krt8)
  Exosomal proteins of colorectal cancer cells
   25626 (Krt8)
  Exosomal proteins of bladder cancer cells
   25626 (Krt8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Filament Keratin_2_head TPR_MLP1_2 Spc7 CENP-F_leu_zip CALCOCO1 TolA_bind_tri TSNAXIP1_N ADIP DivIC APG6_N SIMPL Prominin ABC_tran_CTD
Motif
Other DBs
NCBI-GeneID: 25626
NCBI-ProteinID: NP_955402
RGD: 2984
Ensembl: ENSRNOG00000009779
Vega: OTTRNOG00000001600
UniProt: Q10758
Position
7q36
AA seq 483 aa AA seqDB search
MSVRVTQKSYKMSTSGPRAFSSRSFTSGPGARISSSSFSRVGSSSSSFRGSLGGFGGAGV
GGITAVTVNQSLLNPLKLEVDPNIQAVRTQEKEQIKTLNNKFASFIDKVRFLEQQNKMLE
TKWSLLQQQKTSRSNMDNMFESYINNLRRQLEALGQEKLKLEVELGNMQGLVEDFKNKYE
DEINKRTEMENEFVLIKKDVDEAYMNKVELESRLEGLTDEINFLRQIHEEEIRELQSQIS
DTSVVLSMDNSRSLDMDSIIAEVRAQYEEIANRSRAEAETMYQIKYEELQTLAGKHGDDL
RRSKTEISEMNRNISRLQAEIDALKGQRATLEAAIADAEQRGELAVKDANAKLEDLKNAL
QKAKQDMARQLREYQELMNVKLALDIEIATYRKLLEGEESRLESGMQNMSIHTKTTSGYA
GGLSSSYGGLTSPGFSYGMSSFQPGFGSVGGSSTYSRTKAVVVKKIETRDGKLVSESSDI
MSK
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtcagggtgactcagaaatcctacaagatgtccacctccggtccccgggccttc
agcagccgctcgttcacgagtggacccggtgcccgcatcagctcttccagcttttcccgg
gtgggcagcagcagcagcagcttccgcggaagcctgggcggctttggcggggctggtgtc
gggggcatcacggcggtcacggtgaaccagagcctgctgaaccccttgaagctggaggtg
gaccccaacatccaggctgtgcgcactcaggagaaagagcagatcaagaccctgaacaac
aagttcgcctctttcattgacaaggtacgcttcctggagcagcagaacaagatgctggag
accaaatggagcttgctgcaacagcagaagacatccaggagcaacatggacaacatgttt
gagagttacatcaacaacctccgtcggcagctggaagccctgggccaggagaagctgaag
ctggaggtggagcttggcaacatgcagggcctggtggaggacttcaagaataagtatgag
gatgagatcaacaagcgtacagagatggagaatgagtttgtcctcatcaagaaggatgtg
gatgaagcctacatgaacaaggtggagcttgagtcccgcctggaaggactgaccgacgag
atcaacttcctccggcagatccatgaagaggagatccgtgagctgcagtctcagatctca
gacacgtctgtggtgctgtccatggacaacagccgctccctggacatggacagcatcatt
gctgaagttcgtgcccagtatgaggagatcgccaaccgcagccgagctgaggccgaaacc
atgtaccagattaagtatgaggaattgcagaccctggctgggaagcacggggatgatcta
cgtcgctcgaagacggagatctctgagatgaaccgtaacatcagccgcctgcaggcggag
attgacgccctcaaaggccagagggcaaccctggaggcggccattgctgatgcagagcag
cgtggggaactggccgtgaaggatgccaatgccaagctggaggatctgaagaatgccctg
cagaaggccaagcaggacatggcccggcagctgcgcgagtaccaggagctgatgaacgtc
aagctggcgcttgacatcgagatcgccacctaccgcaagctgctggagggcgaggagagc
aggctggagtctgggatgcagaacatgagcatccacacgaagaccaccagtggctacgca
ggaggactgagttcatcctacgggggactcactagccccggcttcagctatggaatgagc
tctttccagcccggcttcggttctgttgggggatccagcacttatagccgcaccaaggct
gtggtcgtgaagaagattgaaacccgagatgggaaactggtgtctgagtcttctgacatc
atgtccaagtga

DBGET integrated database retrieval system