KEGG   Rattus norvegicus (rat): 25627Help
Entry
25627             CDS       T01003                                 

Gene name
Cma1, MCP3P, Mcpt5
Definition
(RefSeq) chymase 1
  KO
K01329  chymase [EC:3.4.21.39]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04614  Renin-angiotensin system
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09152 Endocrine system
   04614 Renin-angiotensin system
    25627 (Cma1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:rno01002]
    25627 (Cma1)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.39  chymase
     25627 (Cma1)
Peptidases [BR:rno01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   25627 (Cma1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2
Motif
Other DBs
NCBI-GeneID: 25627
NCBI-ProteinID: NP_037224
RGD: 2365
Ensembl: ENSRNOG00000020563
UniProt: P50339
Position
15p13
AA seq 247 aa AA seqDB search
MNLHALCLLLLLLGSSTKAGEIIGGTECIPHSRPYMAYLEIVTSDNYLSACSGFLIRRNF
VLTAAHCAGRSITVLLGAHNKTYKEDTWQKLEVEKQFIHPNYDKRLVLHDIMLLKLKEKA
KLTLGVGTLPLSANFNFIPPGRMCRAVGWGRTNVNEPASDTLQEVKMRLQEPQSCKHFTS
FQHKSQLCVGNPKKMQNVYKGDSGGPLLCAGIAQGIASYVHPNAKPPAVFTRISHYRPWI
NKILREN
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgaatctccatgctctgtgtctgctgctccttctcctgggttccagcaccaaagctggg
gagatcatcgggggcacggagtgcataccacactcccgcccctacatggcctatctagaa
attgtcacttctgacaattacctgtcagcctgcagtggcttcctgatcagacgaaacttt
gtgctgactgcagctcactgtgcaggacggtctataaccgtcctcctaggagctcataac
aaaacatataaagaagacacatggcagaagctcgaggttgaaaagcaattcattcatcca
aactatgataagcgtttggttctccatgacatcatgttactgaagttgaaggagaaagcc
aagctaaccctaggcgtgggaaccctcccactctcggccaacttcaacttcattccaccc
gggagaatgtgcagggcagttggctggggcagaacaaacgtgaatgaaccagcctctgac
acactgcaggaagtaaagatgagactccaggagccccaatcctgcaaacacttcaccagt
tttcaacacaagtcccagttgtgtgtgggcaaccccaagaagatgcaaaatgtatacaag
ggagactctggaggacctctcctgtgtgctgggatagcccaaggcattgcatcctacgta
catccgaatgcaaagccccctgctgtcttcaccagaatctcccattacagaccctggatc
aataagatcttgagggagaattaa

DBGET integrated database retrieval system