KEGG   Rattus norvegicus (rat): 25629Help
Entry
25629             CDS       T01003                                 

Gene name
Plin1, PERIA, Plin
Definition
(RefSeq) perilipin 1
  KO
K08768  perilipin-1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03320  PPAR signaling pathway
rno04371  Apelin signaling pathway
rno04714  Thermogenesis
rno04923  Regulation of lipolysis in adipocytes
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    25629 (Plin1)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    25629 (Plin1)
   03320 PPAR signaling pathway
    25629 (Plin1)
  09159 Environmental adaptation
   04714 Thermogenesis
    25629 (Plin1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Perilipin DUF719 RRN3
Motif
Other DBs
NCBI-GeneID: 25629
NCBI-ProteinID: NP_001295074
RGD: 3351
Ensembl: ENSRNOG00000015086
UniProt: A0A0G2JTP6
Position
1q31
AA seq 518 aa AA seqDB search
MSMNKGPTLLDGDLPEQENVLQRVLQLPVVSGTCECFQKTYNSTKEAHPLVASVCNAYEK
GVQGASNLAAWSMEPVVRRLSTQFTAANELACRGLDHLEEKIPALQYPPEKIASELKGTI
STRLRSARNSISVPIASTSDKVLGATLAGCELALGMAKETAEYAANTRVGRLASGGADLA
LGSIEKVVEYLLPPDKVESAPSSGRQKMQKAPKAKPSLLRRVSTLANTLSRHTMQTTARA
LKRGHSLAMWIPGVAPLSSLAQWGASAAMQVVSRRQSEVRVPWLHNLAASKDENHEDQTD
TEGEETDEEEEEEESEAEENVLREVTALPTPLGFLGGVVHTVQKTLQNTISAVTWAPAAV
LGTVGRILHLTPAQAVSSTKGRAMSLSDALKGVTDNVVDTVVHYVPLPRLSLMEPESEFQ
DIDNPPAEVERKGSGSRPASPESTARPGQPRGSLRSVRGLSAPSCPDLDDKTETSARPGF
LAMPREKPARRVSDSFFRPSVMEPILGRTQYSQLRKKS
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgtccatgaacaagggcccgaccctgctggatggagacctccctgaacaggagaatgtg
ctccagagagtcctgcagctgcctgtggtgagcgggacctgtgagtgcttccagaagacc
tataacagcaccaaagaagcccaccccctggtggcctctgtgtgcaatgcctatgagaag
ggtgtacagggtgccagcaacctggctgcctggagcatggagccggtggtccgccggctc
tccacccagttcacagctgctaatgagttggcctgcagaggcctggaccacctggaggaa
aagatcccggctcttcaataccctccggaaaagatcgcctctgaactgaagggcaccatc
tctacccgcctccgaagcgccaggaacagcatcagcgtgcccattgcaagcacttctgac
aaggttctgggggccactctggccggctgtgagcttgccttggggatggccaaggagaca
gcggaatatgctgccaacacccgagttggccgactggcctctggaggggctgatctggct
ttgggaagcatcgagaaggtggtagaatatctcctgccaccagacaaggtggagtcagcc
ccttcttcaggacggcaaaagatgcagaaggctcccaaggccaaaccaagccttttgagg
agggtcagcaccctggccaacactctttctcgacacaccatgcagaccacagcacgggcc
ctgaagcggggtcactctctggccatgtggatcccgggtgtggcacccctgagcagcctg
gcccagtggggtgcatcggcagccatgcaggtggtgtcccggcggcagagtgaggtacgg
gtgccctggttgcacaacctggcagcctccaaggatgagaaccatgaagaccagacagac
acagagggagaggagacagatgaggaggaagaagaagaagagtcagaggccgaggagaac
gtgctcagagaggtaacagccctgcccacccctctcggcttcctgggtggtgtggtacac
accgtgcagaagactctgcagaacaccatctcggcggtgacatgggcacctgcggctgtg
ctgggcacggtgggaaggatcctacacctcacaccagcccaggctgtctcctccaccaaa
gggagggccatgtccctatccgatgccctgaagggtgttacggataacgtggtagacact
gtggtacactatgtcccgcttcccaggctgtccctgatggagcccgagagcgaattccaa
gacatcgataatcctccagcagaggtggagcgcaaagggtcggggtcgcggcccgccagc
ccagagtccacggcgcgcccgggccagccccgcggcagcttgcgcagcgtgcggggtctc
agcgcgccctcttgccccgatctggatgacaaaaccgagacatcagcgcgtcctggcttc
ctggctatgcccagagagaagcctgcgcgcagggtcagcgacagcttcttccggcccagc
gtcatggagcccatcctgggccgcacgcagtacagccagctgcgcaagaagagctga

DBGET integrated database retrieval system