KEGG   Rattus norvegicus (rat): 25631Help
Entry
25631             CDS       T01003                                 

Gene name
Smad3, Madh3, Smad_3, mad3
Definition
(RefSeq) SMAD family member 3
  KO
K04500  mothers against decapentaplegic homolog 2/3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04068  FoxO signaling pathway
rno04110  Cell cycle
rno04144  Endocytosis
rno04218  Cellular senescence
rno04310  Wnt signaling pathway
rno04350  TGF-beta signaling pathway
rno04371  Apelin signaling pathway
rno04390  Hippo signaling pathway
rno04520  Adherens junction
rno04550  Signaling pathways regulating pluripotency of stem cells
rno04659  Th17 cell differentiation
rno04926  Relaxin signaling pathway
rno04933  AGE-RAGE signaling pathway in diabetic complications
rno05142  Chagas disease (American trypanosomiasis)
rno05161  Hepatitis B
rno05166  Human T-cell leukemia virus 1 infection
rno05200  Pathways in cancer
rno05210  Colorectal cancer
rno05212  Pancreatic cancer
rno05220  Chronic myeloid leukemia
rno05225  Hepatocellular carcinoma
rno05226  Gastric cancer
rno05321  Inflammatory bowel disease (IBD)
Module
rno_M00680  TGF-beta signaling
rno_M00681  Activin signaling
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    25631 (Smad3)
   04350 TGF-beta signaling pathway
    25631 (Smad3)
   04390 Hippo signaling pathway
    25631 (Smad3)
   04371 Apelin signaling pathway
    25631 (Smad3)
   04068 FoxO signaling pathway
    25631 (Smad3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    25631 (Smad3)
  09143 Cell growth and death
   04110 Cell cycle
    25631 (Smad3)
   04218 Cellular senescence
    25631 (Smad3)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    25631 (Smad3)
   04550 Signaling pathways regulating pluripotency of stem cells
    25631 (Smad3)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    25631 (Smad3)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    25631 (Smad3)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    25631 (Smad3)
  09162 Cancers: Specific types
   05210 Colorectal cancer
    25631 (Smad3)
   05212 Pancreatic cancer
    25631 (Smad3)
   05225 Hepatocellular carcinoma
    25631 (Smad3)
   05226 Gastric cancer
    25631 (Smad3)
   05220 Chronic myeloid leukemia
    25631 (Smad3)
  09163 Immune diseases
   05321 Inflammatory bowel disease (IBD)
    25631 (Smad3)
  09167 Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    25631 (Smad3)
  09172 Infectious diseases: Viral
   05166 Human T-cell leukemia virus 1 infection
    25631 (Smad3)
   05161 Hepatitis B
    25631 (Smad3)
  09174 Infectious diseases: Parasitic
   05142 Chagas disease (American trypanosomiasis)
    25631 (Smad3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MH2 MH1 IRF-3
Motif
Other DBs
NCBI-GeneID: 25631
NCBI-ProteinID: NP_037227
RGD: 3032
Ensembl: ENSRNOG00000008620
UniProt: P84025
Position
8q24
AA seq 425 aa AA seqDB search
MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNV
NTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEV
CVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETP
PPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYEL
NQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIG
GEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGF
EAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIR
CSSVS
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtccatcctgcccttcacccccccgatcgtgaagcgcctgctgggctggaagaag
ggcgagcagaacgggcaggaggagaagtggtgcgagaaggcggtcaagagcttggtgaag
aagctcaagaagacggggcagttggacgagctggagaaggccatcaccacgcagaacgtg
aacaccaagtgcattaccatccccaggtcactggatggccggctgcaggtatcccatcgg
aaggggctcccccatgtcatctactgccgcttgtggcggtggcccgacctgcacagccac
catgagttacgggccatggagctctgtgagttcgccttcaacatgaagaaggatgaagtg
tgtgtaaatccttaccactatcagagagtagagacaccagtgctacctccagtgttggtg
ccacgccacaccgagatcccggccgagttcccccctctggatgactacagccattccatc
cccgagaacactaacttccccgctggcattgaaccccagagcaatattccagaaacccca
cctcctggctacctgagtgaagatggagaaactagcgaccaccagatgaaccacagcatg
gacgcaggctctccaaacctctccccgaatccgatgtccccagcacacaataacttggac
ctacagccagtcacctactgtgagccggccttttggtgctccatctcctactacgagctg
aaccagcgagttggggagacattccacgcttcacagccgtccatgacagtagatggcttc
actgatccctccaattcagagcgcttctgtctgggcctgctgtccaatgttaaccggaat
gcagccgtggagcttacaaggcggcacattgggaggggtgtgcggctctactacattgga
ggggaggtctttgcagagtgcctcagtgacagtgctattttcgtccagtctcccaactgc
aaccagcgctatggctggcaccctgccactgtctgcaagatacccccaggctgcaacctg
aagatcttcaacaaccaggaatttgctgccctcctagctcagtctgtcaaccagggcttt
gaggctgtctaccagttgactcgcatgtgcaccatccgcatgagcttcgtcaaaggctgg
ggagccgagtacaggagacagacagtgaccagcaccccctgctggatcgagctacacctg
aatgggcccttgcagtggcttgacaaggtcctcacccagatgggttcccccagcatccgc
tgttccagcgtgtcttag

DBGET integrated database retrieval system