KEGG   Rattus norvegicus (rat): 25633
Entry
25633             CDS       T01003                                 

Gene name
Dnase1
Definition
(RefSeq) deoxyribonuclease 1
  KO
K11994  deoxyribonuclease-1 [EC:3.1.21.1]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    25633 (Dnase1)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.1  deoxyribonuclease I
     25633 (Dnase1)
SSDB
Motif
Pfam: Exo_endo_phos
Other DBs
NCBI-GeneID: 25633
NCBI-ProteinID: NP_037229
RGD: 2510
Ensembl: ENSRNOG00000006873
UniProt: P21704
Position
10q12
AA seq 284 aa
MRYTGLMGILLTLVNLLQLAATLRIAAFNIRTFGDTKMSNATLSSYIVKILSRYDIAVVQ
EVRDTHLVAVGKLLDELNRDIPDNYRYIISEPLGRKSYKEQYLFVYRPSQVSVLDSYHYD
DGCEPCGNDTFSREPAIVKFFSPYTEVREFAIVPLHSAPTEAVSEIDALYDVYLDVRQKW
GLEDIMFMGDFNAGCSYVTSSQWSSIRLRTSPIFQWLIPDSADTTATSTHCAYDRIVVAG
ALLQAAVVPSSAVPFDFQAEYRLTNQMAEAISDHYPVEVTLRKT
NT seq 855 nt   +upstreamnt  +downstreamnt
atgaggtacacagggctgatgggaatactgctcaccctggtcaacctgctgcagctggct
gcgactctgagaattgcagccttcaacatccggacttttggggatactaagatgtctaat
gccaccctctctagctacattgtgaaaatcctgagtcgctatgacattgctgtggtccaa
gaggtcagagacactcacctggttgctgttgggaagctactggatgaactcaatcgggac
atccctgacaactatcgctatataatcagtgagccgctgggccgcaaaagctacaaggaa
cagtacctttttgtgtacaggcccagccaggtgtctgttttggatagctatcattatgac
gatggctgtgaaccctgtggaaatgacaccttcagccgagagccagccattgtcaagttc
ttttccccatacactgaggtccgagagtttgcgattgtgcccttgcactcagccccaaca
gaggctgtgagtgagatcgatgccctctacgatgtttatctagatgtccggcaaaagtgg
ggcctggaggacatcatgttcatgggagatttcaatgctggctgcagctacgtcacttcc
tcccaatggtcttccattcgccttcggacaagccccatcttccagtggctgatccctgac
agtgcggacaccacagccacatccacacactgtgcttatgacaggattgtggttgctgga
gctctgctccaggctgctgttgttcccagctcggctgtcccctttgacttccaagcagaa
tacagacttaccaaccagatggctgaagccatcagtgaccattacccagtggaggtgaca
ctcagaaagacctga

DBGET integrated database retrieval system