KEGG   Rattus norvegicus (rat): 25634
Entry
25634             CDS       T01003                                 

Gene name
G6pc1
Definition
(RefSeq) glucose-6-phosphatase
  KO
K01084  glucose-6-phosphatase [EC:3.1.3.9]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00010  Glycolysis / Gluconeogenesis
rno00052  Galactose metabolism
rno00500  Starch and sucrose metabolism
rno01100  Metabolic pathways
rno04068  FoxO signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04152  AMPK signaling pathway
rno04910  Insulin signaling pathway
rno04920  Adipocytokine signaling pathway
rno04922  Glucagon signaling pathway
rno04931  Insulin resistance
rno04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    25634 (G6pc1)
   00052 Galactose metabolism
    25634 (G6pc1)
   00500 Starch and sucrose metabolism
    25634 (G6pc1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    25634 (G6pc1)
   04151 PI3K-Akt signaling pathway
    25634 (G6pc1)
   04152 AMPK signaling pathway
    25634 (G6pc1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    25634 (G6pc1)
   04922 Glucagon signaling pathway
    25634 (G6pc1)
   04920 Adipocytokine signaling pathway
    25634 (G6pc1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    25634 (G6pc1)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    25634 (G6pc1)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.9  glucose-6-phosphatase
     25634 (G6pc1)
SSDB
Motif
Pfam: PAP2
Other DBs
NCBI-GeneID: 25634
NCBI-ProteinID: NP_037230
RGD: 2644
Ensembl: ENSRNOG00000051171
Vega: OTTRNOG00000000813
UniProt: P43428
Position
10
AA seq 357 aa
MEERMNVLHDFGIQSTRYLQVNYEDSQDWFVLVSVIADLRNAFYVLFPIWFHIQETVGIN
LLWVAVVGDWFNLVFKWILFGQRPYWWVLDTDYYSNSSVPLIKQFPVTCETGPGSPSGHA
MGTAGVYYVMVTSTLAIFRGKKKSTYGFRCLNVVLWLGYWAVQLNVCLSRIYLAAHFPHQ
VVAGVLSGIAVAETFSHIRGIYNASLQRYCLITFFLFGFALGFYLLLKGLGVDLLWTLEK
AKRWCERPEWVHLDTTPFASLFKNLGTLLGLGLALNSSMYRKSCKGELRKSLPFRLACIV
ASLGLLHLFDSLKPPSQIESIFYILSFCKSATVPFASVSLIPYCLARLLGQTHKKSL
NT seq 1074 nt   +upstreamnt  +downstreamnt
atggaggaaagaatgaacgtgctccacgactttgggatccagtcgactcgctacctccaa
gtgaattacgaagactcccaggactggtttgtcttggtgtctgtgatcgctgacctcagg
aacgccttctatgtcctctttcccatctggttccacattcaagagactgtgggcatcaat
ctcctctgggtggcagtggttggagactggttcaacctcgtctttaagtggattcttttt
ggacagcgcccgtattggtgggtcctggacactgactattacagcaacagctccgtgcct
ctgataaaacagttccccgtcacctgtgagactggaccagggagtccctcgggccatgcc
atgggcacagcaggtgtatactacgttatggttacttctactctcgctatctttcgtgga
aagaaaaagtcaacgtatggattccggtgcttgaatgtcgtcttgtggttgggatactgg
gctgtgcagctgaacgtctgtctgtcccggatctaccttgcggctcactttccccatcag
gtggtggctggagtcttgtcaggcattgctgtggctgaaactttcagccacatccggggc
atctacaatgccagcctccagaggtactgtctcatcaccttcttcctgtttggtttcgca
cttggattttacctgctgctaaaggggctaggggtggacctcctgtggactttggagaag
gccaagagatggtgtgagcgccccgagtgggtccaccttgacactacaccctttgccagc
ctcttcaaaaacctggggaccctcttggggttggggctggccctcaactccagcatgtac
cgcaagagctgcaaaggagaactgcgcaagtcgctcccattccgtttggcctgcatcgtg
gcctccttgggcctgctgcatctctttgactcgctgaagcccccgtcccagattgagtcg
atcttctacatcttgtctttctgcaagagtgcgaccgtcccctttgcatctgtcagtctt
atcccctactgcctagcccggctcctgggacagacacacaagaagtctttgtaa

KEGG   Rattus norvegicus (rat): 303565
Entry
303565            CDS       T01003                                 

Gene name
G6pc3
Definition
(RefSeq) glucose-6-phosphatase 3
  KO
K01084  glucose-6-phosphatase [EC:3.1.3.9]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00010  Glycolysis / Gluconeogenesis
rno00052  Galactose metabolism
rno00500  Starch and sucrose metabolism
rno01100  Metabolic pathways
rno04068  FoxO signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04152  AMPK signaling pathway
rno04910  Insulin signaling pathway
rno04920  Adipocytokine signaling pathway
rno04922  Glucagon signaling pathway
rno04931  Insulin resistance
rno04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    303565 (G6pc3)
   00052 Galactose metabolism
    303565 (G6pc3)
   00500 Starch and sucrose metabolism
    303565 (G6pc3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    303565 (G6pc3)
   04151 PI3K-Akt signaling pathway
    303565 (G6pc3)
   04152 AMPK signaling pathway
    303565 (G6pc3)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    303565 (G6pc3)
   04922 Glucagon signaling pathway
    303565 (G6pc3)
   04920 Adipocytokine signaling pathway
    303565 (G6pc3)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    303565 (G6pc3)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    303565 (G6pc3)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.9  glucose-6-phosphatase
     303565 (G6pc3)
SSDB
Motif
Pfam: PAP2
Other DBs
NCBI-GeneID: 303565
NCBI-ProteinID: NP_788266
RGD: 727875
Ensembl: ENSRNOG00000020902
UniProt: Q6AZ83
Position
10
AA seq 346 aa
MESTLSAGIMMAEALQNQLPGLENMWLWVTFLADPKNLFQFYFPAVYYASRRLGISLFWI
AFITEWLNLVFKWFLFGDRPFWWVHESGYSAQTPVQIHQFPSSCETGPGSPSGHCMITGA
ALWPVMIAISSQVASQTRSPWVRVIPGLAYCTFLLAVGLSRVFLLAHFPHQVLAGLLAGV
ILGWLLSPRVPMERELSFYGLTALTLMLGASLMYWTLFTLGLDLSWSINLASKWCDRPEW
VLVDSRPFASLSRDSGSALGLGIALHTPCYAQIRRVHLGNGQKIACFVLAMGLLVFLEWL
GHPPQISLFYIFNFLKFTLWPCLVVALVPWMVHTLSAQEAPPIRSS
NT seq 1041 nt   +upstreamnt  +downstreamnt
atggagtccactctgagcgccggcatcatgatggctgaagcactacaaaaccagcttccc
gggctagagaatatgtggctctgggtcacctttctggccgatcccaagaacctctttcag
ttctacttccccgcggtctactacgcctcccgccgcctgggcatctccctgttctggatc
gccttcattactgagtggctcaacctcgtcttcaagtggtttctgtttggagacaggccc
ttctggtgggtgcatgaatccgggtactccgcccagactccagtccagattcaccagttc
ccttcttcttgtgagactggtccaggcagcccctctggtcactgcatgatcacaggcgca
gctttgtggcccgtaatgatagccatttcatctcaggtggcctctcagacccgcagcccc
tgggtgagggtgattcctggcctggcctactgcaccttcctattggcagtcggcctgtct
cgggtcttcctcttagcacatttccctcaccaagtgttggctggccttctagctggtgtt
atccttggctggctgttgagtccccgggtgcccatggagcgggaacttagcttttatggg
ttgactgctctgaccctcatgctgggtgccagcctcatgtattggacgctctttacactg
ggcctagatctttcctggtccatcaacctggcttccaagtggtgtgatcggcccgagtgg
gtgctcgttgacagtcggccctttgcctcactgagccgtgactcaggatctgccctaggt
ctgggcatcgccctccacactccctgttatgcccagattcggcgagtacacctaggaaat
ggccagaaaatagcttgctttgtgctagccatggggctgctggtcttcctggaatggctg
ggccatccacctcagataagcctcttctacatcttcaacttcctcaaatttacactctgg
ccatgcctggtcgtggccctcgtgccctggatggtgcatacattgagtgcccaggaagcc
ccacccattcgctcttcttga

KEGG   Rattus norvegicus (rat): 681817
Entry
681817            CDS       T01003                                 

Gene name
G6pc2
Definition
(RefSeq) LOW QUALITY PROTEIN: glucose-6-phosphatase 2
  KO
K01084  glucose-6-phosphatase [EC:3.1.3.9]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00010  Glycolysis / Gluconeogenesis
rno00052  Galactose metabolism
rno00500  Starch and sucrose metabolism
rno01100  Metabolic pathways
rno04068  FoxO signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04152  AMPK signaling pathway
rno04910  Insulin signaling pathway
rno04920  Adipocytokine signaling pathway
rno04922  Glucagon signaling pathway
rno04931  Insulin resistance
rno04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    681817 (G6pc2)
   00052 Galactose metabolism
    681817 (G6pc2)
   00500 Starch and sucrose metabolism
    681817 (G6pc2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    681817 (G6pc2)
   04151 PI3K-Akt signaling pathway
    681817 (G6pc2)
   04152 AMPK signaling pathway
    681817 (G6pc2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    681817 (G6pc2)
   04922 Glucagon signaling pathway
    681817 (G6pc2)
   04920 Adipocytokine signaling pathway
    681817 (G6pc2)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    681817 (G6pc2)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    681817 (G6pc2)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.9  glucose-6-phosphatase
     681817 (G6pc2)
SSDB
Other DBs
NCBI-GeneID: 681817
NCBI-ProteinID: XP_017447807
RGD: 69398
Position
3
AA seq 236 aa
MTLNTGSPCGLAMGSSCVWYVMVTAALNYTVSWMDESSNTLHRVKGCLKGSGSQAHASIS
FQSLGTLVAEAFKHTPGIYVVSLNVYLKTNVFLFLWGPAFTFYLLLRLLGIALLWSVSIT
KKCCANSDWIHIDSMPFAGLVRNLRVLFGLGFSINSEMFLLSCQGKNGAKLSLHLLCALT
SLTTMQLYCFIKIPTHMEPLFYLLSFCKSTSIPLTVVALIPYCVHMLMRPSERRIK
NT seq 711 nt   +upstreamnt  +downstreamnt
atgacgctcaatacaggaagtccatgtggcctcgcaatgggctcatcatgtgtctggtat
gtcatggtaacagccgccttaaactacactgtcagctggatggacgagtcctctaacact
ctgcacagagtaaagggatgcctgaagggctcagggtcacaagctcatgccagtatctct
ttccaatccctagggacgctagtagccgaggccttcaaacacactccaggaatctacgtg
gtcagcttgaatgtgtacctgaagaccaatgtcttcctcttcctctggggacctgcattc
accttttacctgcttctcagactgcttggtattgccctgttgtggtctgtgtccatcacc
aaaaagtgttgtgccaactcagactggatccacattgacagcatgccttttgctggactt
gtgagaaacctccgggtcctatttggcttgggtttctccatcaactcagaaatgttcctt
ctgagctgccagggaaaaaatggcgccaagctgagcctccacttgctctgtgctctgaca
tcactgaccacaatgcaactttattgcttcatcaagatcccaactcacatggaaccttta
ttttacctgttgtctttctgtaaaagtacatccattccactcaccgtggtggctctaatt
ccctattgtgtacacatgttaatgagacccagtgagaggaggattaaatag

DBGET integrated database retrieval system