KEGG   Rattus norvegicus (rat): 25635
Entry
25635             CDS       T01003                                 

Gene name
Mc4r
Definition
(RefSeq) melanocortin 4 receptor
  KO
K04202  melanocortin 4 receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    25635 (Mc4r)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    25635 (Mc4r)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Peptide
   Melanocortin
    25635 (Mc4r)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4
Other DBs
NCBI-GeneID: 25635
NCBI-ProteinID: NP_037231
RGD: 3057
Ensembl: ENSRNOG00000018692
UniProt: P70596
Position
18q12.1
AA seq 332 aa
MNSTHHHGMYTSLHLWNRSSHGLHGNASESLGKGHSDGGCYEQLFVSPEVFVTLGVISLL
ENILVIVAIAKNKNLHSPMYFFICSLAVADMLVSVSNGSETIVITLLNSTDTDAQSFTVN
IDNVIDSVICSSLLASICSLLSIAVDRYFTIFYALQYHNIMTVRRVGIIISCIWAACTVS
GVLFIIYSDSSAVIICLITMFFTMLVLMASLYVHMFLMARLHIKRIAVLPGTGTIRQGAN
MKGAITLTILIGVFVVCWAPFFLHLLFYISCPQNPYCVCFMSHFNLYLILIMCNAVIDPL
IYALRSQELRKTFKEIICFYPLGGICELPGRY
NT seq 999 nt   +upstreamnt  +downstreamnt
atgaactccacccaccaccatggcatgtatacttccctccacctctggaaccgcagcagc
cacgggctgcacggcaatgccagcgagtctctggggaaggggcactcagacggaggatgc
tatgagcaactttttgtctcccccgaggtgtttgtgactctgggtgtcataagcctgttg
gagaacattctagtgatcgtggcgatagccaagaacaagaacctgcactcacccatgtac
tttttcatctgtagtctggctgtggcggacatgctggtgagcgtttcgaacgggtcagaa
accatcgtcatcaccctgctaaacagtacggacacggacgcccagagcttcaccgtgaat
attgataatgtcattgactctgtgatctgtagctccttgctcgcatccatttgcagcctg
ctttccattgcagtggacaggtatttcactatcttttacgcgctccagtaccataacatt
atgacggttaggcgggtcgggatcatcatcagttgtatctgggcagcttgcacagtatcg
ggcgttctttttatcatttactcggacagcagcgctgtcatcatctgcctcattaccatg
ttcttcaccatgctggttctcatggcctctctctatgtccacatgttcctgatggcgagg
cttcacattaagaggatcgctgtcctcccgggcacgggtaccatccgtcagggtgccaac
atgaagggcgcaattaccttgaccattctgattggagtgtttgttgtctgctgggccccg
tttttcctccatttactgttctacatctcttgtcctcagaatccatactgcgtgtgcttc
atgtctcattttaacttgtatctcatactgatcatgtgtaacgctgtcatcgaccctctc
atttatgccctgcggagtcaagaactgaggaaaaccttcaaagagatcatctgtttctac
cccctgggaggcatctgtgagttacctggcaggtattaa

DBGET integrated database retrieval system