KEGG   Rattus norvegicus (rat): 25637Help
Entry
25637             CDS       T01003                                 

Gene name
Ptger1, EP1
Definition
(RefSeq) prostaglandin E receptor 1
  KO
K04258  prostaglandin E receptor 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04020  Calcium signaling pathway
rno04080  Neuroactive ligand-receptor interaction
rno05163  Human cytomegalovirus infection
rno05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    25637 (Ptger1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    25637 (Ptger1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    25637 (Ptger1)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    25637 (Ptger1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    25637 (Ptger1)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Lipid
   Prostaglandin
    25637 (Ptger1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1
Motif
Other DBs
NCBI-GeneID: 25637
NCBI-ProteinID: NP_001265404
RGD: 3434
Ensembl: ENSRNOG00000004094
UniProt: P70597
Position
19q11
AA seq 405 aa AA seqDB search
MSPYGLNLSLVDEATTCVTPRVPNTSVVLPTGGNGTSPALPIFSMTLGAVSNVLALALLA
QVAGRLRRRRSTATFLLFVASLLAIDLAGHVIPGALVLRLYTAGRAPAGGACHFLGGCMV
FFGLCPLLLGCGMAVERCVGVTQPLIHAARVSVARARLALALLAAMALAVALLPLVHVGH
YELQYPGTWCFISLGPPGGWRQALLAGLFAGLGLAALLAALVCNTLSGLALLRARWRRRR
SRRFRENAGPDDRRRWGSRGLRLASASSASSITSTTAALRSSRGGGSARRVHAHDVEMVG
QLVGIMVVSCICWSPLLVLVVLAIGGWNSNSLQRPLFLAVRLASWNQILDPWVYILLRQA
MLRQLLRLLPLRVSAKGGPTELSLTKSAWEASSLRSSRHSGFSHL
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgagcccctacgggcttaacctgagcctagtggatgaggcaacaacgtgtgtaacaccc
agggtccccaatacatctgtggtgctgccaacaggcggtaacggcacatcaccagcgctg
cctatcttctccatgacgctgggtgctgtgtccaacgtgctggcgctggcgctgctggcc
caggttgcaggcagactgcggcgccgccgctcgactgccaccttcctgttgttcgtcgcc
agcctgcttgccatcgacctagcaggccatgtgatcccgggcgccttggtgcttcgcctg
tatactgcaggacgtgcgcccgctggcggggcctgtcatttcctgggcggctgcatggtc
ttctttggcctgtgcccacttttgcttggctgtggcatggccgtggagcgctgcgtgggt
gtcacgcagccgctgatccacgcggcgcgcgtgtccgtagcccgcgcacgcctggcacta
gccctgctggccgccatggctttggcagtggcgctgctgccactagtgcacgtgggtcac
tacgagctacagtaccctggcacttggtgtttcattagccttgggcctcctggaggttgg
cgccaggcgttgcttgcgggcctcttcgccggccttggcctggctgcgctccttgccgca
ctagtgtgtaatacgctcagcggcctggcgctccttcgtgcccgctggaggcggcgtcgc
tctcgacgtttccgagagaacgcaggtcccgatgatcgccggcgctgggggtcccgtgga
ctccgcttggcctccgcctcgtctgcgtcatccatcacttcaaccacagctgccctccgc
agctctcggggaggcggctccgcgcgcagggttcacgcacacgacgtggaaatggtgggc
cagctcgtgggcatcatggtggtttcgtgcatctgctggagccccctgctggtattggtg
gtgttggccatcgggggctggaactctaactccctgcagcggccgctctttctggctgta
cgcctcgcgtcgtggaaccagatcctggacccatgggtgtacatcctgctgcgccaggct
atgctgcgccaacttcttcgcctcctacccctgagggttagtgccaagggtggtccaacg
gagctgagcctaaccaagagtgcctgggaggccagttcactgcgtagctcccggcacagt
ggcttcagccacttgtga

DBGET integrated database retrieval system