KEGG   Rattus norvegicus (rat): 25642Help
Entry
25642             CDS       T01003                                 

Gene name
Cyp3a23/3a1, CYP, CYP3A23, Cyp3a1, Cyp3a3, RL33, cDEX
Definition
(RefSeq) cytochrome P450, family 3, subfamily a, polypeptide 23/polypeptide 1
  KO
K07424  cytochrome P450 family 3 subfamily A [EC:1.14.14.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00140  Steroid hormone biosynthesis
rno00591  Linoleic acid metabolism
rno00830  Retinol metabolism
rno01100  Metabolic pathways
rno05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    25642 (Cyp3a23/3a1)
   00591 Linoleic acid metabolism
    25642 (Cyp3a23/3a1)
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    25642 (Cyp3a23/3a1)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    25642 (Cyp3a23/3a1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:rno00199]
    25642 (Cyp3a23/3a1)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     25642 (Cyp3a23/3a1)
Cytochrome P450 [BR:rno00199]
 Cytochrome P450, animal type
  CYP3 family
   25642 (Cyp3a23/3a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450 Miga
Motif
Other DBs
NCBI-GeneID: 25642
NCBI-ProteinID: NP_037237
RGD: 628626
UniProt: Q06884
Position
12p11
AA seq 502 aa AA seqDB search
MDLLSALTLETWVLLAVVLVLLYGFGTRTHGLFKKQGIPGPKPLPFFGTVLNYYMGLWKF
DVECHKKYGKIWGLFDGQMPLFAITDTEMIKNVLVKECFSVFTNRRDFGPVGIMGKAISV
SKDEEWKRYRALLSPTFTSGRLKEMFPVIEQYGDILVKYLRQEKGKPVPVKEVFGAYSMD
VITSTSFGVNVDSLNNPKDPFVEKAKKLLRIDFFDPLFLSVVLFPFLTPVYEMLNICMFP
KDSIEFFKKFVYRMKETRLDSVQKHRVDFLQLMMNAHNDSKDKESHTALSDMEITAQSII
FIFAGYEPTSSTLSFVLHSLATHPDTQKKLQEEIDRALPNKAPPTYDTVMEMEYLDMVLN
ETLRLYPIGNRLERVCKKDVEINGVFMPKGSVVMIPSYALHRDPQHWPEPEEFRPERFSK
ENKGSIDPYVYLPFGNGPRNCIGMRFALMNMKLALTKVLQNFSFQPCKETQIPLKLSRQG
LLQPTKPIILKVVPRDEIITGS
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atggacctgctttcagctctcacactggaaacctgggtcctcctggcagtcgtcctggtg
ctcctctacggatttgggacccgcacacatggacttttcaagaaacaggggattcctggg
cccaaacctctgcctttttttggcactgtgctgaattactatatgggtttatggaaattc
gatgtggagtgccataaaaagtatggaaaaatatgggggttgtttgatggtcaaatgcct
ctgtttgccatcacggacacagaaatgatcaagaatgtgctagtgaaggaatgcttttct
gtcttcacaaaccggcgggattttggcccagtggggattatggggaaagccatctctgta
tctaaggatgaggagtggaagagatatagagccttgctgtcacccacgttcaccagtgga
agactcaaggagatgttccctgtcatcgaacagtatggagacattttggtaaaatacttg
aggcaagagaaaggcaaacctgtccctgtgaaagaagtgtttggtgcctacagcatggat
gtgatcaccagcacatcatttggagtgaatgttgattccctcaacaacccgaaggatcct
tttgtggagaaagccaagaagctcttaagaattgatttttttgatccgttgttcttgtca
gtagtactctttccattcctcacgccagtatatgagatgttaaacatctgcatgttccca
aaagattcaatagaatttttcaaaaaatttgtgtacagaatgaaggaaacccgcctggat
tctgtgcagaagcatcgagtggattttcttcagctgatgatgaatgctcataatgattct
aaagacaaagaatctcatacagccctatccgatatggagatcacagcccagtcaatcatt
tttatttttgctggatatgaacccaccagcagcacactttcctttgtcctgcattccctg
gccactcacccagatacacagaagaaactgcaggaggagatcgacagggctctgcccaat
aaggcacctcccacctatgatactgtgatggaaatggaatacctggatatggtgttgaat
gaaaccctcagattgtatccaattggtaatagacttgagagagtctgtaaaaaagatgtt
gaaatcaatggtgtgtttatgcccaaagggtcagtggtcatgattccatcttatgctctt
caccgtgatccacagcactggccagagcctgaggaatttcgcccagaaaggttcagcaag
gagaacaagggcagcattgatccttatgtatatctgccctttggaaatggacccaggaac
tgcattggcatgaggtttgctctcatgaatatgaaactcgctctcactaaagttctgcaa
aacttctccttccagccttgtaaggaaacacagatacctctgaaattaagcagacaagga
cttcttcaaccaacaaaacccattattctaaaggttgtgccacgggatgaaatcataact
ggatcatga

DBGET integrated database retrieval system