KEGG   Rattus norvegicus (rat): 25643Help
Entry
25643             CDS       T01003                                 

Gene name
Gnai3, GIP3A
Definition
(RefSeq) G protein subunit alpha i3
  KO
K04630  guanine nucleotide-binding protein G(i) subunit alpha
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04015  Rap1 signaling pathway
rno04022  cGMP-PKG signaling pathway
rno04024  cAMP signaling pathway
rno04062  Chemokine signaling pathway
rno04071  Sphingolipid signaling pathway
rno04261  Adrenergic signaling in cardiomyocytes
rno04360  Axon guidance
rno04371  Apelin signaling pathway
rno04540  Gap junction
rno04611  Platelet activation
rno04670  Leukocyte transendothelial migration
rno04713  Circadian entrainment
rno04723  Retrograde endocannabinoid signaling
rno04724  Glutamatergic synapse
rno04725  Cholinergic synapse
rno04726  Serotonergic synapse
rno04727  GABAergic synapse
rno04728  Dopaminergic synapse
rno04730  Long-term depression
rno04914  Progesterone-mediated oocyte maturation
rno04915  Estrogen signaling pathway
rno04916  Melanogenesis
rno04921  Oxytocin signaling pathway
rno04923  Regulation of lipolysis in adipocytes
rno04924  Renin secretion
rno04926  Relaxin signaling pathway
rno04928  Parathyroid hormone synthesis, secretion and action
rno04934  Cushing syndrome
rno04971  Gastric acid secretion
rno05012  Parkinson disease
rno05030  Cocaine addiction
rno05032  Morphine addiction
rno05034  Alcoholism
rno05133  Pertussis
rno05142  Chagas disease (American trypanosomiasis)
rno05145  Toxoplasmosis
rno05163  Human cytomegalovirus infection
rno05170  Human immunodeficiency virus 1 infection
rno05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    25643 (Gnai3)
   04371 Apelin signaling pathway
    25643 (Gnai3)
   04071 Sphingolipid signaling pathway
    25643 (Gnai3)
   04024 cAMP signaling pathway
    25643 (Gnai3)
   04022 cGMP-PKG signaling pathway
    25643 (Gnai3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    25643 (Gnai3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    25643 (Gnai3)
   04670 Leukocyte transendothelial migration
    25643 (Gnai3)
   04062 Chemokine signaling pathway
    25643 (Gnai3)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    25643 (Gnai3)
   04915 Estrogen signaling pathway
    25643 (Gnai3)
   04914 Progesterone-mediated oocyte maturation
    25643 (Gnai3)
   04921 Oxytocin signaling pathway
    25643 (Gnai3)
   04926 Relaxin signaling pathway
    25643 (Gnai3)
   04928 Parathyroid hormone synthesis, secretion and action
    25643 (Gnai3)
   04916 Melanogenesis
    25643 (Gnai3)
   04924 Renin secretion
    25643 (Gnai3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    25643 (Gnai3)
  09154 Digestive system
   04971 Gastric acid secretion
    25643 (Gnai3)
  09156 Nervous system
   04724 Glutamatergic synapse
    25643 (Gnai3)
   04727 GABAergic synapse
    25643 (Gnai3)
   04725 Cholinergic synapse
    25643 (Gnai3)
   04728 Dopaminergic synapse
    25643 (Gnai3)
   04726 Serotonergic synapse
    25643 (Gnai3)
   04730 Long-term depression
    25643 (Gnai3)
   04723 Retrograde endocannabinoid signaling
    25643 (Gnai3)
  09158 Development
   04360 Axon guidance
    25643 (Gnai3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    25643 (Gnai3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    25643 (Gnai3)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    25643 (Gnai3)
  09165 Substance dependence
   05030 Cocaine addiction
    25643 (Gnai3)
   05032 Morphine addiction
    25643 (Gnai3)
   05034 Alcoholism
    25643 (Gnai3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    25643 (Gnai3)
  09171 Infectious disease: bacterial
   05133 Pertussis
    25643 (Gnai3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    25643 (Gnai3)
   05163 Human cytomegalovirus infection
    25643 (Gnai3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    25643 (Gnai3)
   05142 Chagas disease (American trypanosomiasis)
    25643 (Gnai3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    25643 (Gnai3)
   04031 GTP-binding proteins [BR:rno04031]
    25643 (Gnai3)
Exosome [BR:rno04147]
 Exosomal proteins
  Proteins found in most exosomes
   25643 (Gnai3)
GTP-binding proteins [BR:rno04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 1 (Gi/o) [OT]
    25643 (Gnai3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G-alpha Arf Gtr1_RagA Roc TniB AAA_29 FtsK_SpoIIIE AAA_16
Motif
Other DBs
NCBI-GeneID: 25643
NCBI-ProteinID: NP_037238
RGD: 2714
Ensembl: ENSRNOG00000019465
UniProt: P08753
Position
2q34
AA seq 354 aa AA seqDB search
MGCTLSAEDKAAVERSKMIDRNLREDGEKAAKEVKLLLLGAGESGKSTIVKQMKIIHEDG
YSEDECKQYKVVVYSNTIQSIIAIIRAMGRLKIDFGEAARADDARQLFVLAGSAEEGVMT
SELAGVIKRLWRDGGVQACFSRSREYQLNDSASYYLNDLDRISQTNYIPTQQDVLRTRVK
TTGIVETHFTFKELYFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEM
NRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKRSPLTICYPEYTGSNTYEEAA
AYIQCQFEDLNRRKDTKEVYTHFTCATDTKNVQFVFDAVTDVIIKNNLKECGLY
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgggctgcacgttgagcgccgaggacaaggcggcggtggagcggagtaagatgatcgac
cgcaacttgcgggaggacggagagaaagcggccaaagaagtgaagctgctgctgctcggc
gctggagaatctggtaaaagtactattgtgaaacagatgaaaatcattcatgaggatggc
tattccgaggacgagtgtaagcagtataaagttgtcgtctacagcaataccattcagtcc
atcattgcaatcataagagccatgggacggttgaagattgattttggggaagctgccaga
gcggatgatgcccgacagttatttgttttagctggcagtgctgaggaaggagtcatgact
tcagaactagcaggcgtgattaaacgtttatggcgagatggcggggtgcaggcatgcttc
agcaggtccagggaatatcagctcaatgattctgcttcatattacctaaatgatttggat
agaatatcccagaccaactacattccaactcagcaagatgttcttcggacgagagtgaag
actacaggcattgtggagacccacttcaccttcaaggagctctacttcaaaatgtttgat
gtaggtggccaaagatccgaacggaaaaagtggatccactgttttgagggagtgacagca
attatcttttgtgtggctctcagtgattacgaccttgttctggctgaggacgaggaaatg
aaccgaatgcatgaaagcatgaaattgtttgacagcatttgtaacaacaaatggtttaca
gacacttcaatcattctcttccttaataagaaagacctttttgaggaaaaaataaagagg
agtccattaacaatctgttatccagaatacacaggttccaatacgtacgaagaggcagct
gcttacatccagtgccagtttgaagatctgaaccgaagaaaggacaccaaggaggtctac
actcactttacctgtgccactgacaccaaaaacgtgcagtttgtttttgatgctgttaca
gatgtcatcattaaaaacaacttaaaggaatgtgggctttactga

DBGET integrated database retrieval system