KEGG   Rattus norvegicus (rat): 25645Help
Entry
25645             CDS       T01003                                 

Gene name
Adrb3, ADRB
Definition
(RefSeq) adrenoceptor beta 3
  KO
K04143  adrenergic receptor beta-3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04020  Calcium signaling pathway
rno04022  cGMP-PKG signaling pathway
rno04080  Neuroactive ligand-receptor interaction
rno04714  Thermogenesis
rno04923  Regulation of lipolysis in adipocytes
rno04924  Renin secretion
rno04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    25645 (Adrb3)
   04022 cGMP-PKG signaling pathway
    25645 (Adrb3)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    25645 (Adrb3)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    25645 (Adrb3)
   04924 Renin secretion
    25645 (Adrb3)
  09154 Digestive system
   04970 Salivary secretion
    25645 (Adrb3)
  09159 Environmental adaptation
   04714 Thermogenesis
    25645 (Adrb3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    25645 (Adrb3)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Biogenic amine
   Adrenaline
    25645 (Adrb3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srx 7TM_GPCR_Srv
Motif
Other DBs
NCBI-GeneID: 25645
NCBI-ProteinID: NP_037240
RGD: 2061
Ensembl: ENSRNOG00000012674
Vega: OTTRNOG00000002135
UniProt: P26255
Position
16q12.3
AA seq 400 aa AA seqDB search
MAPWPHKNGSLAFWSDAPTLDPSAANTSGLPGVPWAAALAGALLALATVGGNLLVITAIA
RTPRLQTITNVFVTSLATADLVVGLLVMPPGATLALTGHWPLGATGCELWTSVDVLCVTA
SIETLCALAVDRYLAVTNPLRYGTLVTKRRARAAVVLVWIVSATVSFAPIMSQWWRVGAD
AEAQECHSNPRCCSFASNMPYALLSSSVSFYLPLLVMLFVYARVFVVAKRQRRLLRRELG
RFPPEESPRSPSRSPSPATVGTPTASDGVPSCGRRPARLLPLGEHRALRTLGLIMGIFSL
CWLPFFLANVLRALVGPSLVPSGVFIALNWLGYANSAFNPLIYCRSPDFRDAFRRLLCSY
GGRGPEEPRVVTFPASPVASRQNSPLNRFDGYEGERPFPT
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atggctccgtggcctcacaaaaacggctctctggctttctggtcagacgcccccaccttg
gaccccagtgcagccaacaccagtgggttgccaggggtgccatgggcagcggcattggct
ggagcattgctggcgctggccacggtgggaggcaacctgctggtaatcacagctatcgcc
cgcacgccgagactacagaccataaccaacgtgttcgtgacttcgctggccacagctgac
ttggtagtgggactcctcgtaatgccaccaggggccacattggcgctgactggccactgg
cccttgggcgcaactggctgcgagctgtggacgtcagtggacgtgctctgtgtaactgcc
agcatcgagaccctgtgcgccctggctgtagaccgctacctagccgtcaccaaccctctg
cgttacggcacgctggttaccaagcgccgcgcccgggcggcagtagtcctggtgtggatc
gtgtccgccaccgtgtcctttgcgcccatcatgagccagtggtggcgtgtaggggcagac
gctgaggcgcaagagtgtcactccaatccgcgctgctgttcctttgcctccaatatgccc
tacgcgctgctctcctcctccgtctccttctaccttcccctccttgtgatgctcttcgtc
tatgctcgagtgttcgtcgtagctaagcgccagcggcgtttgctgcgccgggagctgggc
cgttttccgcccgaggagtctccgcggtctccgtcgcgctctccatcccctgccacagtc
gggacacccacggcatcggatggagtgccctcctgcgggcggcggcctgcgcgcctccta
ccgctcggggaacaccgcgccctgcgcaccttgggtctcattatgggcatcttctctctg
tgctggctgcccttctttctggccaacgtgctgcgcgcactcgtggggccctccctagtt
cccagcggagttttcatcgccctgaactggttgggctatgccaactctgccttcaacccg
ctcatctactgccgcagcccggactttcgcgacgccttccgtcgtcttctgtgcagctac
ggtggccgtggaccggaagagccacgcgtggtcaccttcccagctagccctgttgcgtcc
aggcagaactcaccgctcaacaggtttgatggctatgaaggtgagcgtccatttcccaca
tga

DBGET integrated database retrieval system