KEGG   Rattus norvegicus (rat): 25648Help
Entry
25648             CDS       T01003                                 

Gene name
Slc7a1, Atrc1, CAT1, Cat-1
Definition
(RefSeq) solute carrier family 7 member 1
  KO
K13863  solute carrier family 7 (cationic amino acid transporter), member 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    25648 (Slc7a1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    25648 (Slc7a1)
Transporters [BR:rno02000]
 Solute Carrier Family (SLC)
  SLC7: Cationic amino acid transporter/glycoprotein-associated
   25648 (Slc7a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AA_permease_2 AA_permease AA_permease_C
Motif
Other DBs
NCBI-GeneID: 25648
NCBI-ProteinID: NP_037243
RGD: 3716
Ensembl: ENSRNOG00000000924
UniProt: Q3V5G8
Position
12p11
AA seq 624 aa AA seqDB search
MGCKNLLSLGQQTLRRKVVDCSREESRLSRCLNTYDLVALGVGSTLGAGVYVLAGAVARE
NAGPAIVISFLIAALASVLAGLCYGEFGARVPKTGSAYLYSYVTVGELWAFITGWNLILS
YIIGTSSVARAWSATFDELIGKPIGEFSRQHMALNAPGVLAQTPDIFAVIIIIILTGLLT
LGVKESAMVNKIFTCINVLVLCFIMVSGFVKGSIENWQLTENKSSPLCGNNDTNVKYGEG
GFMPFGFSGVLSGAATCFYAFVGFDCIATTGEEVKNPQKAIPVGIVASLLICFIAYFGVS
AALTLMMPYFCLDTDSPLPGAFKYRGWEEAKYAVAVGSLCALSTSLLGSMFPMPRVIYAM
AEDGLLFKFLAKINDRTKTPIIATVTSGAIAAVMAFLFELKDLVDLMSIGTLLAYSLVAA
CVLVLRYQPEQPNLVYQMARTTDELDQVDQNEMVSASESQTGFLPAAEKFSLKTILSPKN
MEPSKFSGLIVNISAGLLAVLIITVCIVAVLGREALAEGTLWAVFVMTGSVLLCMLVTGI
IWRQPESKTKLSFKVPFVPVLPVLSIFVNIYLMMQLDQGTWVRFAVWMLIGFAIYFGYGA
WHSEEASLAAGQAKTPDSNLDQCK
NT seq 1875 nt NT seq  +upstreamnt  +downstreamnt
atgggctgcaaaaacctgttgagcctgggtcagcagacgctgcgccggaaagtggtggac
tgcagccgggaggagagccggctgtcccgctgcctcaacacctatgatctggtagctctt
ggggtgggcagcaccttgggcgctggtgtctacgtcctagccggtgcagtggcccgtgag
aatgctggtcctgccatcgtcatctccttcctgatcgctgctcttgcctcagtgctggcc
ggcctgtgctatggcgagtttggtgcccgtgtccccaagacgggctcagcctacctctac
agctatgtgacagtgggggagctctgggccttcatcactggctggaacctgattctctcc
tacatcatcggtacatccagcgtggcaagagcctggagtgcaacttttgacgagctgata
ggcaaacccatcggagagttctcgcgtcaacacatggccctgaacgcccctggggtgctg
gcccaaaccccggatatatttgctgtgattataattatcatcctgacaggactgttaact
ctcggtgtgaaagaatcagccatggtcaacaaaatcttcacctgtatcaatgtcctggtc
ttgtgcttcatcatggtgtcgggattcgtgaaaggctccattgagaactggcagctcacg
gagaataaatccagtcctctctgtgggaacaatgacacaaacgtgaaatacggtgaggga
gggttcatgccctttggattctctggtgtcctgtcaggggcagcgacctgcttttatgcc
ttcgtgggctttgactgcatcgccaccacaggggaagaagtcaagaacccccagaaggcc
attcctgtgggcattgtggcgtccctcctcatttgcttcatagcttactttggggtgtcc
gctgctctcaccctcatgatgccctacttctgcctggacactgacagcccactgcctggc
gccttcaagtacaggggctgggaagaagctaagtatgcagtggccgtgggctccctctgc
gcactctccaccagtctcctaggttccatgttccccatgccccgagttatctatgccatg
gctgaagatggactactgtttaaatttttggccaaaatcaacgataggaccaaaacacca
ataatcgctactgtgacctcaggcgccatcgctgctgtgatggccttcctctttgaactg
aaggatctggtggacctcatgtccattggtactctcctggcttactctttggtggctgcc
tgtgttttggtcttacggtaccagccagaacaacctaatctggtataccagatggccaga
accaccgatgagctagaccaggtagaccagaatgagatggtcagtgccagtgagtcccag
acaggctttttaccagcagccgagaagttttctctgaaaaccatactctcacccaagaac
atggagccgtccaaattctcagggctaattgtgaacatttcagccggcctcctagccgtt
cttatcatcaccgtgtgcattgtggccgtgcttggaagagaggccctggctgaagggacg
ctgtgggcagtctttgtaatgacagggtcagtcctcctctgcatgctggtgacgggcatc
atctggaggcagcctgagagcaagaccaagctctcgtttaaggtaccctttgtccccgta
cttcctgtcttaagcatctttgtgaacatctatctcatgatgcaactggaccagggcacg
tgggtccggttcgcagtgtggatgctgataggctttgccatctactttggctatggggcc
tggcacagtgaggaagcatccctggctgctggccaggcaaagactcctgatagcaacttg
gaccagtgcaaatga

DBGET integrated database retrieval system