KEGG   Rattus norvegicus (rat): 25649
Entry
25649             CDS       T01003                                 

Symbol
Apoa2
Name
(RefSeq) apolipoprotein A-II preproprotein
  KO
K08758  apolipoprotein A-II
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03320  PPAR signaling pathway
rno04979  Cholesterol metabolism
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    25649 (Apoa2)
  09154 Digestive system
   04979 Cholesterol metabolism
    25649 (Apoa2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    25649 (Apoa2)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   25649 (Apoa2)
SSDB
Motif
Pfam: ApoA-II SGT1 Apolipoprotein BAR
Other DBs
NCBI-GeneID: 25649
NCBI-ProteinID: NP_037244
RGD: 2131
Ensembl: ENSRNOG00000003500
UniProt: P04638
Position
13
AA seq 102 aa
MKLLAMVALLVTICSLEGALVRRQAAETDVQTLFSQYLQSLTDYGKDLMEKAQPSEIQNQ
AKAYFQNAQERLTPFVQRTGTNLMDFLSRLMSPEEKPAPAAK
NT seq 309 nt   +upstreamnt  +downstreamnt
atgaagctgcttgcaatggttgcactgctggtcaccatctgtagcctagaaggagctttg
gttcggagacaggcagcggagacggatgtgcagaccctgttcagccagtatcttcagagt
ttaactgactatggcaaggatttgatggagaaggcccagccctcagagattcagaaccaa
gccaaggcttactttcagaatgcacaggagagactgacaccctttgtccagagaactggg
acgaatctgatggacttcttaagccgtttaatgagccccgaggagaaaccagctcctgcc
gctaagtga

DBGET integrated database retrieval system