KEGG   Rattus norvegicus (rat): 25653Help
Entry
25653             CDS       T01003                                 

Gene name
Tshb
Definition
(RefSeq) thyroid stimulating hormone, beta
  KO
K05251  thyrotropin subunit beta
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04024  cAMP signaling pathway
rno04080  Neuroactive ligand-receptor interaction
rno04918  Thyroid hormone synthesis
rno04923  Regulation of lipolysis in adipocytes
rno05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    25653 (Tshb)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    25653 (Tshb)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    25653 (Tshb)
   04918 Thyroid hormone synthesis
    25653 (Tshb)
 09160 Human Diseases
  09163 Immune disease
   05320 Autoimmune thyroid disease
    25653 (Tshb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cys_knot
Motif
Other DBs
NCBI-GeneID: 25653
NCBI-ProteinID: NP_037248
RGD: 3910
Ensembl: ENSRNOG00000016793
UniProt: P04652 A0A0F7RQR3
Position
2q34
AA seq 138 aa AA seqDB search
MNAVVLFSVLFALACGQVSSFCIPTEYMMYVDRRECAYCLTINTTICAGYCMTRDINGKL
FLPKYALSQDVCTYRDFTYRTVEIPGCPHHVAPYFSYPVALSCKCGKCNTDYSDCTHEAV
KTNYCTKPQTFYLGGFSG
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atgaatgctgtcgttctcttttccgtgcttttcgctcttgcttgtgggcaagtgtcatcg
ttttgtattcccactgagtatatgatgtacgtggacaggagagagtgtgcctactgcctg
accatcaacaccaccatctgcgctgggtattgtatgacacgggatatcaatggcaaactg
tttcttcccaagtacgcactctctcaggatgtctgtacatacagagacttcacctacaga
acggtggaaataccgggatgcccacaccatgttgctccttatttctcctaccccgttgcc
ctgagctgcaagtgtggcaagtgtaacactgactacagcgactgtacacacgaggctgtc
aaaaccaactactgcaccaagccacagacattctatctggggggattttctggttaa

DBGET integrated database retrieval system