KEGG   Rattus norvegicus (rat): 25655
Entry
25655             CDS       T01003                                 

Gene name
Gja4, CXN37
Definition
(RefSeq) gap junction protein, alpha 4
  KO
K07613  gap junction alpha-4 protein
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    25655 (Gja4)
Transporters [BR:rno02000]
 Other transporters
  Pores ion channels [TC:1]
   25655 (Gja4)
SSDB
Motif
Pfam: Connexin Connexin43 ECSCR
Other DBs
NCBI-GeneID: 25655
NCBI-ProteinID: NP_067686
RGD: 2691
Ensembl: ENSRNOG00000014357
UniProt: Q03190 A0A654IEV1
Position
5q36
AA seq 333 aa
MGDWGFLEKLLDQVQEHSTVVGKIWLTVLFIFRILILGLAGESVWGDEQSDFECNTAQPG
CTNVCYDQAFPISHIRYWVLQFLFVSTPTLIYLGHVIYLSRREERLRQKEGELRALPSKD
PHVERALAAIEHQMAKISVAEDGRLRIRGALMGTYVISVLCKSVLEAGFLYGQWRLYGWT
MEPVFVCQRAPCPHVVDCYVSRPTEKTIFIIFMLVVGVISLVLNLLELVHLLCRCVSREI
KARRDHDTRPAQGSASDPYPEQVFFYLPMGEGPSSPPCPTYNGLSSTEQNWANLTTEERL
TSTRPPPFVNAAPQGGQKSSSRPNSSASKKQYV
NT seq 1002 nt   +upstreamnt  +downstreamnt
atgggtgactggggcttcctggagaagctgctagaccaggtccaggagcactcgaccgtg
gtgggcaagatctggttaacggtgctcttcatcttccgaatcctcatcctgggcctggct
ggtgagtcggtgtggggcgacgagcagtctgatttcgaatgtaacacagcccagccaggc
tgcaccaatgtgtgctatgaccaggctttccccatctcccacatccgatactgggtgctg
cagttcctcttcgtgagcacacccaccctgatctacctgggccacgtcatttacctgtct
cggcgggaagaacggttgcggcagaaagagggagagcttcgggcactgccatccaaggac
cctcatgtagagcgggcactagcagccatagaacatcagatggccaagatctcggtggca
gaggacggtcgtcttcgcattcgaggggcgctcatgggtacctacgtgatcagtgtgctg
tgtaagagtgtgctggaggcaggcttcctctatggccagtggcgtctctacggctggacc
atggagccggtgtttgtgtgccagcgtgcgccctgcccccacgtcgtggactgctacgtc
tctcgacccaccgagaagaccatcttcatcattttcatgttggtggtaggggtcatctcc
ttggtgctcaacctactggagctggtgcacctgttgtgccgctgtgtcagccgggagata
aaggcacggagggaccatgacacccgcccggctcagggcagtgcctcagacccttaccct
gaacaggttttcttctacctccccatgggcgagggaccctcgtccccaccgtgtcccacc
tacaatgggctctcatccactgagcaaaactgggccaatttgaccaccgaggagagactg
acctctaccagacctcccccatttgtaaatgcagccccccagggtggccagaagtcctct
agccgccccaacagctctgcatccaagaagcagtatgtatag

DBGET integrated database retrieval system