KEGG   Rattus norvegicus (rat): 25663
Entry
25663             CDS       T01003                                 

Gene name
Il1r1
Definition
(RefSeq) interleukin 1 receptor type 1
  KO
K04386  interleukin 1 receptor type I
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04060  Cytokine-cytokine receptor interaction
rno04064  NF-kappa B signaling pathway
rno04380  Osteoclast differentiation
rno04640  Hematopoietic cell lineage
rno04659  Th17 cell differentiation
rno04750  Inflammatory mediator regulation of TRP channels
rno05146  Amoebiasis
rno05163  Human cytomegalovirus infection
rno05166  Human T-cell leukemia virus 1 infection
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    25663 (Il1r1)
   04064 NF-kappa B signaling pathway
    25663 (Il1r1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    25663 (Il1r1)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    25663 (Il1r1)
   04659 Th17 cell differentiation
    25663 (Il1r1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    25663 (Il1r1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    25663 (Il1r1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    25663 (Il1r1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    25663 (Il1r1)
   05163 Human cytomegalovirus infection
    25663 (Il1r1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    25663 (Il1r1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:rno04050]
    25663 (Il1r1)
   04090 CD molecules [BR:rno04090]
    25663 (Il1r1)
Cytokine receptors [BR:rno04050]
 Interleukin receptor families
  IL1 receptor family
   25663 (Il1r1)
CD molecules [BR:rno04090]
 Proteins
  25663 (Il1r1)
SSDB
Motif
Pfam: TIR Ig_2 Ig_3 Ig_6 I-set ig Ig_5 V-set Adeno_E3_CR1
Other DBs
NCBI-GeneID: 25663
NCBI-ProteinID: NP_037255
RGD: 2892
Ensembl: ENSRNOG00000014504
UniProt: Q05KR1
Position
9q22
AA seq 590 aa
MLPRLVTSSAKSSILENMKVLLGFICLIVPLLSLETDKCTEYPNEVISFSSVNEIDIRSC
PLTPNEMHGGTIIWYKNDSKTPISADKDSRIHQQNEHLWFVPAKMEDSGYYYCIMRNSTY
CLKTKITMSVLENDPGLCYNTQASFIQRLHVAGDGSLVCPYLDFFKDENNELPKVQWYKN
CKPLPLDDGNFFGFKNKLMVMNVAEEHRGNYTCRTSYTYQGKQYPVTRVITFITIDDSKR
DRPVIMSPRNETMEADPGSTIQLICNVTGQFTDLVYWKWNGSEIEWDDPILAEDYQFLEH
PSAKRKYTLITTLNVSEVKSQFYRYPFICFVKNTHILETAHVRLVYPVPDFKNYLIGGFA
IFTATAVFCACIYKVFKVDIVLWYRDSCSDFLPPKASDGKTYDAYVLYPKTYGEGSFAYL
DTFVFKLLPEVLEGQFGYKLFICGRDDYVGEDTIEVTNENVKRSRRLIIILVRDMGSFSC
LGQSSEEQIAIYDALIREGIKIILLELEKIQDYEKMPESIQFIKQKHGAICWSGDFKERP
QSAKTRFWKNLRYQMPAQRRSPLSKHHLLTLDPVLDTKEKLQAETHLPLG
NT seq 1773 nt   +upstreamnt  +downstreamnt
atgctgccgaggcttgtgacatcttcggctaaatcctccatcctggagaatatgaaagtg
ctacttgggttcatttgtctcattgtgcctctgctgtcgctggagaccgacaaatgcacg
gagtatccaaatgaggtcatttcattttcatccgtaaatgaaattgacattcgcagctgt
cctcttactccaaacgaaatgcatggcggcaccataatctggtataaaaatgacagcaag
acccccatatcagcggacaaggactccaggattcatcagcagaatgaacatctttggttt
gttcccgccaagatggaggattcaggctattactattgtataatgagaaactcaacatac
tgcctcaaaactaaaataaccatgagtgtcttagagaatgaccctggcttgtgctataac
acacaagccagcttcatacagcggctccatgttgcaggggatggaagtcttgtgtgccct
tatctggattttttcaaagatgaaaataacgagttacccaaagttcagtggtataagaac
tgtaaacctctgcctcttgacgatggaaacttctttggattcaagaataaactgatggtg
atgaatgtggctgaagagcacagagggaactatacttgccgcacgtcctacacataccag
gggaagcaatatcccgtcacacgagtaataacatttatcacaatagatgacagcaagagg
gacagacctgtgattatgagcccacggaatgagacgatggaagctgacccaggatccacg
atacaactgatctgcaacgtcacgggccagttcaccgaccttgtctactggaagtggaat
gggtcggaaattgaatgggacgatccaatcctagccgaagactatcagtttttggaacac
ccttcagccaaaagaaagtacactctcattacaacacttaacgtttcagaggtcaaaagc
cagttttatcgctatccgttcatctgcttcgttaagaacactcatattctggagactgca
cacgtacggttagtatacccagttcctgacttcaagaattacctcatcgggggctttgcc
atcttcacagctacagccgtgttctgtgcttgcatctacaaagtcttcaaggttgatata
gtgctttggtacagggactcctgctctgattttcttcccccaaaagcttcagatggaaag
acctatgatgcctatgttctttatcccaagacctacggagagggatcctttgcatacttg
gatacttttgtgtttaagctgttgccggaggtcttggagggacagtttggatacaaactg
ttcatttgtggaagggatgactatgttggggaagataccatcgaggttactaatgaaaac
gtaaagagaagcagaaggctgatcatcattttagtgagagatatgggaagcttcagctgt
ctgggccagtcatctgaagagcagatagcaatatacgatgccctcatccgggaaggaatt
aaaatcatcctgctcgagttggagaaaatccaagactatgagaaaatgccagaatctatt
caattcattaagcagaagcatggggccatttgctggtcaggagactttaaagaaagaccg
cagtctgccaagaccaggttctggaaaaacttaagataccagatgccagcccaacggcga
tcaccactgtctaaacatcacttactaaccctggatcctgtgctggacactaaggagaaa
ctgcaggcggagacacacttaccacttggctag

DBGET integrated database retrieval system