KEGG   Rattus norvegicus (rat): 25667
Entry
25667             CDS       T01003                                 

Gene name
Bmp3, PBMP3
Definition
(RefSeq) bone morphogenetic protein 3
  KO
K05496  bone morphogenetic protein 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    25667 (Bmp3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    25667 (Bmp3)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   25667 (Bmp3)
SSDB
Motif
Pfam: TGF_beta TGFb_propeptide
Other DBs
NCBI-GeneID: 25667
NCBI-ProteinID: NP_058801
RGD: 2212
Ensembl: ENSRNOG00000002381
UniProt: P49002
Position
14p22
AA seq 468 aa
MAGARGLLCLWLGCFCLNLAQGQRPNLHLPGLRGTESSDRMTGGGPSPDLRPHDKVSEHM
LWLYDRYSGSNRAQATRTPGSQLPGPQPLRGGNTVRSFRAAAAGTLQRKGLHTFNLTSLT
KSENILSATLYFYIGELVNTSVNCPESQGCSHDSQRQHIQIDLSAWTLQSNQSQLLGHLS
VDTAKPYRDSMSWLSKDITQLLRKAKQDEEFLIGFNITSRAHELPKRMLLFPEPYILVYA
NDAAICEPESVVSSLQRHRDFTAGTVPRLDSHVREALSVERRKKRSTGILLPLQNNELPG
AEYQYKEAGVWEERKPYKSLQTQPPEKSRSKKKQRKGPHQKGQTLQFDEQTLKKARRKQW
IEPRNCARRYLKVDFADIGWSEWIISPKSFDAYYCSGACQFPMPKSLKPSNHATIQSIVR
AVGVVSGIPEPCCVPEKMSSLSILFFDENKNVVLKVYPNMTVDSCACR
NT seq 1407 nt   +upstreamnt  +downstreamnt
atggctggggctcgcgggctgctgtgtctgtggctaggttgtttctgcctgaacctggca
cagggacagagaccaaatttgcacctcccgggactccgcgggactgagtcaagcgaccgc
atgacaggtggtggcccgagcccggacctgaggcctcacgacaaggtgtcagagcatatg
ctgtggctctatgacaggtacagcggcagcaacagagcccaggctacccggacaccgggc
tcgcagctcccgggtccccaacccctgcgtggcggtaacacggttcgtagcttcagagcc
gcagccgcaggaactcttcaaagaaagggcttgcacacttttaatctgacttctctaacc
aagtctgagaacattttgtcagccacactgtatttctacattggagaattggtgaacacc
agtgtgaactgtccagaatcccaaggttgttcccatgacagccagagacaacacatccag
atagacctctctgcatggaccctccaatccaaccaaagccagctcttgggtcatctgtca
gtagatacggccaaaccttatagagacagcatgtcttggctgtcaaaagacatcactcag
ctcttacggaaggccaagcaagacgaggagtttctcataggatttaacattacctccaga
gcacacgagcttcccaagaggatgctgcttttcccggaaccttatatcttggtgtatgcc
aacgatgccgccatttgtgagcctgaaagcgtggtatctagcctacagagacaccgcgat
ttcacagcaggaactgtgcccagactggatagccacgtcagagaagccctctctgttgag
aggaggaagaagcgctctactgggatcttgttgccattgcagaacaacgagctccctggg
gccgagtatcagtacaaggaggctggagtgtgggaggagagaaagccttacaagagcctt
cagactcagcctcctgaaaagagccggagcaaaaagaaacagaggaaagggcctcatcaa
aagggacagacactgcagtttgatgagcagacactgaagaaggcgaggcgaaagcagtgg
atcgagcctcggaactgtgcccgcaggtaccttaaagtggactttgccgatattggctgg
agcgaatggattatctcccccaagtcatttgatgcctactattgctccggagcctgccag
ttccccatgccaaagtctttgaagccatcaaatcacgccaccatccagagcatagtgaga
gccgtgggggtcgtctctgggattcctgagccctgctgtgttccggagaagatgtcctcg
ctcagcatcttgttctttgacgagaacaagaatgtggtcctcaaagtctatcctaacatg
acagtagactcttgtgcttgtagataa

DBGET integrated database retrieval system