KEGG   Rattus norvegicus (rat): 25671
Entry
25671             CDS       T01003                                 

Gene name
Smad1
Definition
(RefSeq) mothers against decapentaplegic homolog 1
  KO
K04676  mothers against decapentaplegic homolog 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04350  TGF-beta signaling pathway
rno04390  Hippo signaling pathway
rno04550  Signaling pathways regulating pluripotency of stem cells
rno05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    25671 (Smad1)
   04390 Hippo signaling pathway
    25671 (Smad1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    25671 (Smad1)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    25671 (Smad1)
SSDB
Motif
Pfam: MH2 MH1 IRF-3 DUF4223
Other DBs
NCBI-GeneID: 25671
NCBI-ProteinID: NP_037262
RGD: 3030
Ensembl: ENSRNOG00000018483
UniProt: P97588 Q6P7A6
Position
19
AA seq 468 aa
MNVTSLFSFTSPAVKRLLGWKQGDEEEKWAEKAVDALVKKLKKKKGAMEELEKALSCPGQ
PSNCVTIPRSLDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLECCEFPFGSKQKEV
CINPYHYKRVESPVLPPVLVPRHSEYNPQHSLLAQFRNLGQNEPHMPLNATFPDSFQQPH
SHPFPQSPNSSYPNSPGSSSSTYPHSPTSSDPGSPFQMPADTPPPAYLPPEDPMAQDGSQ
PMDTNMTNMTAPTLPAEINRGDVQAVAYEEPKHWCSIVYYELNNRVGEAFHASSTSVLVD
GFTDPSNNKNRFCLGLLSNVNRNSTIENTRRHIGKGVHLYYVGGEVYAECLSDSSIFVQS
RNCNYHHGFHPTTVCKIPSGCSLKIFNNQEFAQLLAQSVNHGFETVYELTKMCTIRMSFV
KGWGAEYHRQDVTSTPCWIEIHLHGPLQWLDKVLTQMGSPHNPISSVS
NT seq 1407 nt   +upstreamnt  +downstreamnt
atgaatgtgaccagcttgttttcattcacaagcccagctgtgaagagactccttgggtgg
aaacagggcgacgaagaagagaaatgggcggagaaggctgtggacgctttggtgaagaaa
ctgaagaagaagaaaggggccatggaagagctggagaaggccctgagctgccccgggcag
ccgagtaactgtgtcaccattcctcgctccctggatggcaggttgcaggtgtcccaccgg
aagggactgcctcatgtcatttattgccgcgtgtggcgctggcccgacctccagagccat
catgaactaaagcctctggaatgctgcgagttcccatttggttccaagcagaaggaagtc
tgcatcaatccctaccactataagcgagtggagagccccgttctcccaccggtgctggtt
ccgaggcacagcgagtacaaccctcagcacagccttctggctcagttccgaaacctggga
caaaatgagccccacatgccactgaatgccacgttccccgactccttccagcagccacac
agccacccgtttccccagtcccccaacagcagctaccccaactctcctggcagcagcagc
agcacctaccctcactccccgaccagctcagacccgggcagcccttttcagatgccagcc
gacacacccccgcctgcttacctgcctcctgaagaccccatggcccaggatggctctcag
cctatggacacgaacatgacgaacatgacggcaccgacactgcccgcggagatcaataga
ggagatgttcaagcagttgcttacgaggaaccaaaacactggtgctctattgtgtactat
gagctcaacaaccgtgtgggcgaagcgttccatgcctcctccaccagcgtgttggtggat
ggtttcaccgatccttccaacaataagaaccgattctgccttgggctgctctccaatgtt
aaccggaactccactattgaaaataccaggcgacacatcgggaaaggagtccacctttat
tacgtcggaggagaggtgtatgcggagtgcctcagtgacagcagcatcttcgtgcagagt
cggaactgcaactaccaccatggctttcatcccaccacggtctgcaagatccccagcggg
tgcagcttgaaaatcttcaacaaccaagagttcgctcagctactggcgcagtctgtgaac
catgggttcgagacagtgtatgaactcaccaaaatgtgcactattcgaatgagcttcgtg
aagggctggggagcagagtaccaccggcaggatgtcactagcaccccctgctggattgag
atacacctgcatggccctctccagtggctggataaagtccttacccagatgggttcgccc
cacaaccctatttcgtcggtgtcttaa

KEGG   Rattus norvegicus (rat): 59328
Entry
59328             CDS       T01003                                 

Gene name
Smad5
Definition
(RefSeq) mothers against decapentaplegic homolog 5
  KO
K16790  mothers against decapentaplegic homolog 5
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04350  TGF-beta signaling pathway
rno04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    59328 (Smad5)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    59328 (Smad5)
SSDB
Motif
Pfam: MH2 MH1 IRF-3
Other DBs
NCBI-GeneID: 59328
NCBI-ProteinID: NP_067724
RGD: 620158
Ensembl: ENSRNOG00000022870
UniProt: Q9R1V3 B1WBR0
Position
17
AA seq 465 aa
MTSMASLFSFTSPAVKRLLGWKQGDEEEKWAEKAVDALVKKLKKKKGAMEELEKALSSPG
QPSKCVTIPRSLDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLDICEFPFGSKQKE
VCINPYHYKRVESPVLPPVLVPRHNEFNPQHSLLVQFRNLSHNEPHMPQNATFPDSFHQP
NSTPFPLSPNSPYPPSPASSTYPNSPASSGPGSPFQLPADTPPPAYMPPDDQMGQDNSQP
MDTSNNMIPQIMPSISSRDVQPVAYEEPKHWCSIVYYELNNRVGEAFHASSTSVLVDGFT
DPANNKSRFCLGLLSNVNRNSTIENTRRHIGKGVHLYYVGGEVYAECLSDSSIFVQSRNC
NFHHGFHPTTVCKIPSSCSLKIFNNQEFAQLLAQSVNHGFEAVYELTKMCTIRMSFVKGW
GAEYHRQDVTSTPCWIEIHLHGPLQWLDKVLTQMGSPLNPISSVS
NT seq 1398 nt   +upstreamnt  +downstreamnt
atgacgtcaatggccagcctgttttctttcactagtccagccgtgaagcgattgttgggc
tggaaacaaggtgatgaggaagagaaatgggcagaaaaggccgtggatgctttagtgaaa
aagctgaagaagaagaagggcgccatggaggagttggagaaagccttgagcagcccagga
cagccaagcaagtgtgtcactatccccaggtccttggacggccgtttgcaagtctctcac
aggaaaggcttgccccacgttatatattgccgtgtttggcgctggccagatttgcagagc
catcatgagctaaagcctttggatatttgtgagtttccttttggatcgaagcaaaaagaa
gtttgtatcaatccataccactataagagagtggagagtccagtcttacctccagtgtta
gtgcctcgtcacaacgaattcaatccccagcacagccttctggttcagttcaggaacctg
agccacaatgagccgcacatgccccagaatgccacgtttcctgattccttccaccagccc
aacagcactcctttccccttatctcctaacagcccctatcctccttcccctgctagcagc
acatatcccaactcccctgcaagctccggaccaggaagtccatttcaactcccagctgat
acccctccccctgcctatatgccacctgacgatcagatgggtcaggataactcccagcct
atggacacaagcaacaacatgattcctcagatcatgcccagcatatctagcagagatgtt
cagcctgttgcctatgaagagcccaaacactggtgttcgattgtgtactatgaactgaac
aaccgtgtcggggaagctttccatgcgtcttccaccagtgtgttagtagacgggtttaca
gaccctgccaataacaagagccgcttctgcttggggctgctgtccaacgttaatcgcaac
tcaaccatcgagaacaccaggcggcacatcgggaaaggtgtccatctatactacgttggt
ggggaggtgtatgccgagtgtcttagtgacagcagcatctttgttcagagtaggaactgc
aactttcaccatggcttccaccccaccaccgtctgtaagattcccagcagctgcagcctc
aaaatttttaacaatcaggagtttgctcagcttctggctcagtcagtcaaccatgggttt
gaggctgtgtatgagctcaccaagatgtgtaccattcgaatgagttttgtcaagggctgg
ggagcagagtaccaccgacaggatgtaaccagtactccatgctggattgagattcacctc
catgggcctctgcagtggctggataaagtcctgacccagatgggctctccgctgaacccc
atttcttctgtttcatag

KEGG   Rattus norvegicus (rat): 85435
Entry
85435             CDS       T01003                                 

Gene name
Smad9
Definition
(RefSeq) mothers against decapentaplegic homolog 9
  KO
K16791  mothers against decapentaplegic homolog 9
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04350  TGF-beta signaling pathway
rno04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    85435 (Smad9)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    85435 (Smad9)
SSDB
Motif
Pfam: MH2 MH1 IRF-3 DUF4223
Other DBs
NCBI-GeneID: 85435
NCBI-ProteinID: NP_620227
RGD: 71004
Ensembl: ENSRNOG00000058416
UniProt: O54835
Position
2
AA seq 430 aa
MHPSTPISSLFSFTSPAVKRLLGWKQGDEEEKWAEKAVDSLVKKLKKKKGAMDELERALS
CPGQPSKCVTIPRSLDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLECCEFPFGSK
QKEVCINPYHYRRVETPVLPPVLVPRHSEYNPQLSLLAKFRSASLHSEPLMPHNATYPDS
FQQSLGPAPPSSPGHVFPQSPCPTSYPQSPGSPSESDSPYQHSDFRPVCYEEPLHWCSVA
YYELNNRVGETFQASSRSVLIDGFTDPSNNRNRFCLGLLSNVNRNSTIENTRRHIGKGVH
LYYVGGEVYAECVSDSSIFVQSRNCNYQHGFHPATVCKIPSGCSLKVFNNQLFAQLLAQS
VHHGFEVVYELTKMCTIRMSFVKGWGAEYHRQDVTSTPCWIEIHLHGPLQWLDKVLTQMG
SPHNPISSVS
NT seq 1293 nt   +upstreamnt  +downstreamnt
atgcaccccagcacccccatcagctccctcttctccttcaccagccccgcagtgaagagg
ctgctgggctggaagcagggagatgaagaggagaagtgggcagagaaggcagtggactct
ttggtgaagaagttaaagaaaaagaaaggcgccatggatgaactggagagggcgctgagc
tgcccgggccagcctagcaagtgcgttaccatcccacgctccctggatggacgcctccag
gtgtcccaccggaaggggctgccccatgtcatctactgccgcgtgtggcgctggccagat
ctgcaatcccatcatgagctgaagcccttggaatgctgcgagttcccgtttggctctaag
cagaaggaggtctgcatcaacccataccattaccgcagagtggagaccccagttctgcct
ccagtgctggtaccaagacacagcgagtacaaccctcagctcagcctcctggccaagttc
cgaagtgcctcgctgcacagcgaaccgctcatgccgcacaacgccacctaccctgactct
ttccagcagtctctcggtcccgcaccgccctcctcgccaggacacgtgtttccgcagtct
ccatgccccaccagctacccgcagtcccccggaagtccttccgagtcagacagtccttat
caacactcagacttccggccagtttgctacgaggagcccctgcactggtgctctgttgcc
tactacgaactgaacaaccgggtcggagagactttccaggcatcctcccggagtgtgctc
atagatggcttcacagacccctccaataacaggaataggttctgtcttgggcttctttca
aatgtaaacagaaattcgacgatagaaaacaccagaaggcacattggaaagggtgtgcat
ttgtactacgttgggggcgaggtgtacgcggagtgcgtgagcgacagcagcatctttgtc
cagagccggaactgcaactaccagcacggcttccacccggccactgtctgcaagatcccc
agtggctgcagcctcaaggtcttcaacaaccagctcttcgcccagctgctcgcccagtca
gtgcaccacggctttgaagttgtctatgaactgacgaagatgtgcacgattcggatgagc
tttgtgaagggctggggagccgagtatcatcgccaggatgtcacaagcaccccctgctgg
attgagattcatcttcatggaccactgcagtggttggacaaggtgctaactcagatgggc
tccccacacaaccctatttcttcagtgtcttaa

DBGET integrated database retrieval system