KEGG   Rattus norvegicus (rat): 25673Help
Entry
25673             CDS       T01003                                 

Gene name
Anxa5, Anx5, LC5
Definition
(RefSeq) annexin A5
  KO
K16646  annexin A5
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    25673 (Anxa5)
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    25673 (Anxa5)
Exosome [BR:rno04147]
 Exosomal proteins
  Proteins found in most exosomes
   25673 (Anxa5)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate/Haparin
  Others
   25673 (Anxa5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Annexin FeoB_Cyto
Motif
Other DBs
NCBI-GeneID: 25673
NCBI-ProteinID: NP_037264
RGD: 2120
Ensembl: ENSRNOG00000014453
UniProt: P14668
Structure
PDB: 

Position
2q25
AA seq 319 aa AA seqDB search
MALRGTVTDFSGFDGRADAEVLRKAMKGLGTDEDSILNLLTARSNAQRQQIAEEFKTLFG
RDLVNDMKSELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTDEKVLTEIIASRTPEEL
RAIKQAYEEEYGSNLEDDVVGDTSGYYQRMLVVLLQANRDPDTAIDDAQVELDAQALFQA
GELKWGTDEEKFITILGTRSVSHLRRVFDKYMTISGFQIEETIDRETSGNLENLLLAVVK
SIRSIPAYLAETLYYAMKGAGTDDHTLIRVIVSRSEIDLFNIRKEFRKNFATSLYSMIKG
DTSGDYKKALLLLCGGEDD
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atggctctcagaggcaccgtgactgacttctctggattcgacggcagggctgatgccgaa
gttcttcggaaggccatgaaaggcttgggcaccgacgaggacagcatcctgaacctgttg
acagcccggagcaacgctcagcgccagcagattgctgaggagtttaagactctgtttggc
agggaccttgtgaatgacatgaagtctgaactgaccggaaagtttgagaagttaattgtg
gctttgatgaagccctcccggctctacgacgcctacgagctgaaacacgctcttaaggga
gctgggacagatgagaaagtgttgactgaaatcattgcctcaaggacacctgaagagctc
agggccataaaacaagcttatgaagaagaatatggttccaacctggaagatgatgtggtg
ggggatacctcagggtactaccagaggatgttggtggtcctccttcaggccaatagagac
cctgacactgcaattgatgatgctcaagttgaactggatgctcaggcattgttccaggct
ggagagctgaagtgggggacggatgaagaaaagttcatcaccatccttgggacacgcagt
gtgtctcatttaagaagagtgtttgacaagtacatgacaatatcaggatttcagattgag
gaaaccattgaccgagagacctcagggaacttggagaacttactcctggctgtcgtgaag
tctattcggagcatacctgcctaccttgcagagaccctctactatgctatgaagggtgct
gggacggacgatcacaccctcatcagagtcatagtgtcgaggagtgagattgatctgttt
aacatcaggaaggagtttaggaagaacttcgccacgtccctgtactctatgatcaagggc
gacacatctggagactataagaaggccctgctgctcctctgtggaggcgaggatgactga

DBGET integrated database retrieval system