KEGG   Rattus norvegicus (rat): 25675Help
Entry
25675             CDS       T01003                                 

Gene name
Hmgcr, 3H3M
Definition
(RefSeq) 3-hydroxy-3-methylglutaryl-CoA reductase
  KO
K00021  hydroxymethylglutaryl-CoA reductase (NADPH) [EC:1.1.1.34]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00900  Terpenoid backbone biosynthesis
rno01100  Metabolic pathways
rno04152  AMPK signaling pathway
rno04976  Bile secretion
Module
rno_M00095  C5 isoprenoid biosynthesis, mevalonate pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    25675 (Hmgcr)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    25675 (Hmgcr)
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    25675 (Hmgcr)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.34  hydroxymethylglutaryl-CoA reductase (NADPH)
     25675 (Hmgcr)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HMG-CoA_red Sterol-sensing Patched
Motif
Other DBs
NCBI-GeneID: 25675
NCBI-ProteinID: NP_037266
RGD: 2803
Ensembl: ENSRNOG00000016122
UniProt: P51639
Position
2q12
AA seq 887 aa AA seqDB search
MLSRLFRMHGLFVASHPWEVIVGTVTLTICMMSMNMFTGNNKICGWNYECPKFEEDVLSS
DIIILTITRCIAILYIYFQFQNLRQLGSKYILGIAGLFTIFSSFVFSTVVIHFLDKELTG
LNEALPFFLLLIDLSRASALAKFALSSNSQDEVRENIARGMAILGPTFTLDALVECLVIG
VGTMSGVRQLEIMCCFGCMSVLANYFVFMTFFPACVSLVLELSRESREGRPIWQLSHFAR
VLEEEENKPNPVTQRVKMIMSLGLVLVHAHSRWIADPSPQNSTAEQSKVSLGLAEDVSKR
IEPSVSLWQFYLSKMISMDIEQVITLSLALLLAVKYIFFEQAETESTLSLKNPITSPVVT
PKKAQDNCCRREPLLVRRNQKLSSVEEDPGVNQDRKVEVIKPLVAEAETSGRATFVLGAS
AASPPLALGAQEPGIELPSEPRPNEECLQILESAEKGAKFLSDAEIIQLVNAKHIPAYKL
ETLMETHERGVSIRRQLLSAKLAEPSSLQYLPYRDYNYSLVMGACCENVIGYMPIPVGVA
GPLCLDGKEYQVPMATTEGCLVASTNRGCRAISLGGGASSRVLADGMSRGPVVRLPRACD
SAEVKSWLETPEGFAVVKEAFDSTSRFARLQKLHVTLAGRNLYIRLQSKTGDAMGMNMIS
KGTEKALLKLQEFFPELQILAVSGNYCTDKKPAAINWIEGRGKTVVCEAVIPAKVVREVL
KTTTEAMVDVNINKNLVGSAMAGSIGGYNAHAANIVTAIYIACGQDAAQNVGSSNCITLM
EASGPTNEDLYISCTMPSIEIGTVGGGTNLLPQQACLQMLGVQGACKDNPGENARQLARI
VCGTVMAGELSLMAALAAGHLVRSHMVHNRSKINLQDLQGTCTKKAA
NT seq 2664 nt NT seq  +upstreamnt  +downstreamnt
atgttgtcaagacttttccgtatgcatggcctctttgtggcctcccatccctgggaggta
attgtgggaacggtgacacttactatctgtatgatgtccatgaacatgttcaccggcaac
aacaagatctgtggttggaattatgagtgcccaaaatttgaagaggacgtgctgagcagc
gacatcatcatcctcacgataacccggtgcatcgccatcctgtacatctacttccagttc
cagaacctgcgtcagcttgggtcaaagtacattttgggtattgccggcctcttcacaatt
ttctcaagtttcgtcttcagcactgtcgtcattcatttcctcgacaaagaattgacaggc
ttaaatgaagctttgcccttttttctgctcttgattgacctttctagagcgagtgcattg
gccaagtttgccctgagttcaaactcacaggatgaagtaagggagaatatagcgcgtggg
atggcgatcctgggccccacgttcacccttgacgctctggtggaatgtcttgtgattgga
gttggcaccatgtcaggggtgcggcagcttgagatcatgtgctgctttggctgtatgtcc
gtgcttgccaactactttgtcttcatgacattcttcccagcctgcgtgtccctggtccta
gagctttctcgggaaagccgtgagggtcgtccaatttggcagctcagccattttgccaga
gttttagaagaagaagagaataaaccaaacccagtaacccaaagggtcaagatgatcatg
tctttaggcctggttcttgttcacgctcacagtcgctggatagctgatccttctcctcag
aacagcacagcagaacagtctaaggtttccttgggtctggctgaagatgtgtccaagaga
attgagccgagtgtttctctctggcagttttacctctccaagatgatcagcatggacatc
gagcaagtgattaccctgagcttagcgttgcttttggctgtcaagtatattttctttgaa
caagcagagacagaatcaacactctcattaaaaaatcctatcacatctcctgtcgtgacc
ccaaagaaagctcaagacaactgttgtagacgtgagcctctgcttgtgaggaggaaccag
aagctttcgtcagtggaggaggatccaggagtgaaccaagacagaaaagttgaggttata
aaacctttagtggcagaagccgagacttcgggcagagctacgtttgtgcttggcgcctct
gcagccagccctccattggccctgggggcacaggagcctgggatcgaactccccagcgag
cctcgacctaatgaagagtgtctacagatactggagagtgcagagaaaggtgcgaagttc
cttagtgatgcagagatcatccagttggtcaatgctaagcacatcccagcctacaaactg
gaaaccctcatggagacgcacgagcgtggtgtgtctattcgccggcagctcctctccgcc
aagcttgcagagccatcttctctgcagtacctgccttacagagactataattactccttg
gtgatgggagcttgctgtgagaacgtgatcggatatatgcccatccctgttggagtggca
ggacctctgtgcctggatggaaaagagtaccaggtgccaatggcaacaacagaaggttgt
cttgtggccagcacgaacagaggctgcagagcgatcagtcttggtggaggtgccagcagc
cgggtccttgcagatgggatgagccgaggcccagtggtgcgtcttcctcgtgcttgtgac
tcagcagaggtgaagagctggcttgaaacacctgaagggtttgcagtggtaaaggaggcc
ttcgacagcacgagcagatttgcacgtctacagaaacttcacgtgacgctggcaggacgc
aacctctacatccgtctccagtccaaaacgggggacgccatggggatgaacatgatttcc
aagggtacggagaaagcacttctgaagcttcaagagttctttcctgagctgcagattctg
gcggtcagtggtaactattgcaccgacaagaaacctgctgccataaactggatcgaaggg
agaggaaagactgtggtttgtgaagctgtcattccagccaaggtggtgagagaagtatta
aagacgactacggaagctatggttgacgtaaacattaacaagaatcttgtgggctctgcc
atggctggtagcataggaggctacaacgcccatgctgccaacatcgtcactgccatctac
attgcatgtggccaggatgcagcacagaatgtggggagttcaaactgtattacgttaatg
gaagcaagtggtcccacaaatgaagacttatacatcagctgtaccatgccgtctatagag
atcggaaccgtgggtggtgggaccaaccttctacctcagcaagcctgcctgcagatgcta
ggtgttcaaggggcgtgcaaagacaatcctggagaaaatgcacggcagcttgcccgaatt
gtgtgtggcactgtgatggctggtgagttgtccttgatggcagcattggcagcaggacat
cttgtcagaagtcacatggttcacaacagatcaaagataaatttacaagatctgcaggga
acatgcaccaagaaggcagcttga

DBGET integrated database retrieval system