KEGG   Rattus norvegicus (rat): 25678Help
Entry
25678             CDS       T01003                                 

Gene name
Ddr1, Cak, Drd1, PTK3D
Definition
(RefSeq) discoidin domain receptor tyrosine kinase 1
  KO
K05124  discoidin domain receptor family member 1 [EC:2.7.10.1]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    25678 (Ddr1)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:rno04090]
    25678 (Ddr1)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     25678 (Ddr1)
Protein kinases [BR:rno01001]
 Receptor tyrosine kinases (RTK)
  DDR family
   25678 (Ddr1)
CD molecules [BR:rno04090]
 Proteins
  25678 (Ddr1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase F5_F8_type_C Haspin_kinase Kinase-like
Motif
Other DBs
NCBI-GeneID: 25678
NCBI-ProteinID: NP_001159494
RGD: 2252
Ensembl: ENSRNOG00000057125
Vega: OTTRNOG00000001595
UniProt: Q6MG19 B2GVB6
Position
20p12
AA seq 910 aa AA seqDB search
MGTGTLSSLLLLLLLVTIGDADMKGHFDPAKCRYALGMQDRTIPDSDISVSSSWSDSTAA
RHSRLESSDGDGAWCPAGPVFPKEEEYLQVDLRRLHLVALVGTQGRHAGGLGKEFSRSYR
LRYSRDGRRWMDWKDRWGQEVISGNEDPGGVVLKDLGPPMVARLVRFYPRADRVMSVCLR
VELYGCLWRDGLLSYTAPVGQTMQLSEMVYLNDSTYDGYTAGGLQYGGLGQLADGVVGLD
DFRQSQELRVWPGYDYVGWSNHSFPSGYVEMEFEFDRLRSFQTMQVHCNNMHTLGARLPG
GVECRFKRGPAMAWEGEPVRHALGGSLGDPRARAISVPLGGHVGRFLQCRFLFAGPWLLF
SEISFISDVVNDSSDTFPPAPWWPPGPPPTNFSSLELEPRGQQPVAKAEGSPTAILIGCL
VAIILLLLLIIALMLWRLHWRRLLSKAERRVLEEELTVHLSVPGDTILINNRPGPREPPP
YQEPRPRGTPTHSAPCVPNGSALLLSNPAYRLLLATYARPPRGPGPPTPAWAKPTNTQAC
SGDYMEPEKPGAPLLPPPPQNSVPHYAEADIVTLQGVTGGNTYAVPALPPGAVGDGPPRV
DFPRSRLRFKEKLGEGQFGEVHLCEVEDPQDLVTSDFPISVQKGHPLLVAVKILRPDATK
NARNDFLKEVKIMSRLKDPNIIRLLGVCVQDDPLCMITDYMENGDLNQFLSAHQLENKVT
QGLPGDRESDQGPTISYPMLLHVGAQIASGMRYLATLNFVHRDLATRNCLVGENFTIKIA
DFGMSRNLYAGDYYRVQGRAVLPIRWMAWECILMGKFTTASDVWAFGVTLWEVLMLCRSQ
PFGQLTDEQVIENAGEFFRDQGRQVYLSRPPACPQTLYELMLRCWSREPEQRPPFSQLHR
FLADDALNTV
NT seq 2733 nt NT seq  +upstreamnt  +downstreamnt
atggggacagggaccctctcatctctcctgctgctgctactcttggtgacaattggagat
gctgacatgaagggacattttgacccagccaagtgccgctatgccctgggcatgcaggac
cgcaccattccagacagcgatatctctgtgtccagctcctggtcggactctaccgccgcc
cgccacagcaggctggaaagcagtgatggagatggggcttggtgccctgcagggcctgtg
ttccccaaagaagaggagtacctgcaggtggaccttcgtaggctacacctggtggctctg
gtgggcacccagggccgccatgctgggggtctgggcaaagagttctcccgaagctaccgg
ttgcgttactcccgagatggccgacgatggatggactggaaagacagatggggtcaggag
gtgatttcgggtaacgaggatcctgggggagtggtgctgaaggatctcgggccccccatg
gtggcccggctggtccgtttctaccccagggctgaccgggtcatgagtgtctgtcttcgg
gtggagctctatggctgcctctggcgggacggactcttgtcctatacagcccccgtgggg
cagaccatgcaattatctgagatggtgtatctcaatgattccacttacgatggatatact
gctggagggctgcagtacggtggtctgggccaactggcagacggcgtggtggggctggat
gatttcaggcagagccaggagctgcgggtttggccaggctatgactatgtgggatggagc
aaccatagcttccccagcggctacgtggagatggagtttgagtttgaccggctgaggtct
ttccagaccatgcaggtccactgtaacaacatgcacactctgggagcccgcctcccaggc
ggggtggaatgccggtttaaaaggggtccggccatggcctgggaaggagagcctgtacgc
catgccctggggggtagccttggagaccccagagccagggccatctcggtgcccctgggt
ggtcacgtgggccgcttcctgcagtgcagattcctctttgcaggaccctggttactcttc
agtgagatctctttcatctcggatgtggtgaacgactcgtctgacaccttcccaccagcc
ccctggtggccgcctggcccgcctcccaccaacttcagcagcttggagctggagccccgg
ggtcaacagcctgtggccaaggcggaggggagcccaactgccatcctcattggctgcctg
gtggccatcatccttctcctcctccttatcattgccctgatgctctggaggctgcactgg
cgccggctgctcagcaaggcagagcgccgggtgttggaggaggagctgacggttcacctc
tctgtccctggggacaccatcctcatcaacaaccgcccagggccccgagagccaccccct
taccaggaaccccggcctcgggggactccaactcactctgcgccctgcgtccccaatggc
tctgcgttgctgctctccaatccggcctaccgcctccttctggccacttacgcccgtccc
cctcgaggcccgggcccccccacacccgcctgggccaaacccaccaacacccaggcctgc
agtggggactacatggagcccgagaagccgggcgccccacttctacccccacctccccag
aacagcgtcccccattacgccgaggctgacattgtcaccctgcagggcgtcacagggggc
aacacctacgctgttcccgcactgcccccaggggcggttggggatgggccccccagagtg
gatttccctcggtcacggctccgtttcaaggagaagctcggcgagggccaatttggggag
gtacatctctgtgaagtagaggaccctcaagatctggtcactagtgacttccctatcagt
gtgcaaaagggacaccccttgctggtggcagtgaagatcctccggccagatgccaccaaa
aatgccaggaatgacttcctgaaggaggtaaagatcatgtcacggctgaaggacccaaac
atcatccggctcctgggtgtgtgtgtgcaggatgaccctctctgcatgattacagactac
atggagaacggtgacctgaaccaattcctcagtgcccaccagctggagaacaaggtcact
caggggcttcctggggacagagagtctgaccaggggcccacaatcagctaccctatgctg
ttacacgtgggggcccagatcgcctctggcatgcgatatctggccacccttaactttgtg
catcgggacctggccacccggaactgcttggttggggaaaatttcaccatcaaaatcgcc
gactttggcatgagccggaatctctacgctggggattattaccgtgtacagggccgggca
gtgctgcccatcaggtggatggcctgggagtgtatcctcatggggaagttcacaacagcc
agtgatgtgtgggccttcggagtgaccctgtgggaggtgcttatgctctgcaggtcacag
cccttcgggcaactcacagacgagcaggtcatcgagaacgccggcgagttcttcagggac
cagggccggcaggtatacttatccaggccacccgcctgcccgcagaccttgtatgagctg
atgctccggtgttggagccgggagccggagcagcggccgcccttctcccagcttcatcgg
ttcctggcggatgatgcactcaacacagtgtaa

DBGET integrated database retrieval system