KEGG   Rattus norvegicus (rat): 25684Help
Entry
25684             CDS       T01003                                 

Gene name
Mep1a
Definition
(RefSeq) meprin 1 subunit alpha
  KO
K01395  meprin A [EC:3.4.24.18]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    25684 (Mep1a)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    25684 (Mep1a)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    25684 (Mep1a)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.18  meprin A
     25684 (Mep1a)
Peptidases and inhibitors [BR:rno01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   25684 (Mep1a)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   25684 (Mep1a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Astacin MAM EGF EGF_CA
Motif
Other DBs
NCBI-GeneID: 25684
NCBI-ProteinID: NP_037275
RGD: 3080
Ensembl: ENSRNOG00000011022
UniProt: Q64230
Position
9q13
AA seq 748 aa AA seqDB search
MLWTLPVCLLSLSFSAHIAAVSIQHLSTGHDHDDVDVGEQQKDISEINSAAGLNLFQGDI
LLPRTRNALRDPSSRWKPPIPYILADNLDLNAKGAILNAFEMFRLKSCVDFKPYEGESSY
IIFQQFSGCWSMVGDQHVGQNISIGEGCDYKAIIEHEILHALGFFHEQSRTDRDDYVNIW
WNEIMTDYEHNFNTYDDKTITDLNTPYDYESLMHYGPFSFNKNETIPTITTKIPEFNAII
GQRLDFSATDLTRLNRMYNCTRTHTLLDHCAFEKTNICGMIQGTRDDADWVHEDSSQPGQ
VDHTLVGRCKAAGYFMYFNTSSGVTGEVALLESRILYPKRKQQCLQFFYKMTGSPSDRLL
IWVRRDDNTGNVRQLAKIQTFQGDSDHNWKIAHVTLNEEKKFRYVFQGTKGDPGNSDGGI
YLDDITLTETPCPTGVWTIRNISQVLENTVKGDRLVSPRFYNSEGYGFGVTLYPNGRITS
NSGYLGLAFHLYSGDNDVILEWPVENEQAIMTILDQEPDARNRMSLSLMFTTSKYQTSSA
INGSVIWDRPTKVGVYDKDCDCFRSIDWGWGQAISHQMLMRRNFLKDDTLIIFVDFKDLT
HLRQTEVPISSRSVIPRGLLLQGQEPLALGDSRIAMMEESLPRRLDQRQPSRPKRSVENT
GPMEDHNWPQYFRDPCDPNPCQNEGTCVNVKGMASCRCVSGHAFFYTGERCQAMHVHGSL
LGLLIGCITALIFLTFITFSNTYQKLRQ
NT seq 2247 nt NT seq  +upstreamnt  +downstreamnt
atgctgtggacactacctgtgtgtcttctctcactgagtttttctgcccacattgcagct
gtgtccattcagcatctttcgactggacatgaccacgatgatgtagacgttggtgaacaa
cagaaggacatttcagaaatcaactcagctgcaggcctgaacctttttcaaggggacatc
cttctgcccagaaccagaaatgccctgagagatccgtcaagcagatggaagccccccatt
ccatacattctggctgacaatctggatctgaacgccaaaggagccatcctcaatgccttt
gagatgttccgcctcaagtcttgtgtggacttcaagccctatgagggggagagctcgtac
atcatcttccagcagttttctgggtgctggtctatggtcggtgatcaacacgtgggacag
aatatttccattggtgagggctgcgactataaggccatcattgaacatgagatcctgcat
gctctgggattcttccatgagcagtcaaggactgaccgggatgattatgtgaacatctgg
tggaatgaaattatgacagattatgaacataatttcaacacgtatgatgacaagaccatc
acagacctcaacacaccctatgattatgagtccttgatgcactatgggccattttcattt
aacaagaatgaaaccatcccgaccatcactaccaagatccctgagttcaacgccatcatt
ggacagcgcctggatttcagtgccactgatttaacgagactgaatcggatgtacaactgc
accagaacacataccctgctggaccactgtgcgtttgagaagaccaacatctgtggaatg
atccaggggaccagagatgatgctgactgggttcatgaggacagcagtcagcctggacaa
gtggatcacaccttggtgggacggtgcaaagctgctggctacttcatgtacttcaatacc
agctcgggggtgaccggagaggtagcccttctggagtctcggatcctttaccccaagagg
aagcagcagtgtttgcagtttttttataagatgacaggaagcccttcagacagactcctc
atctgggtgagaagggacgacaacacgggcaacgtgcgccagctggccaagatccagact
tttcaaggagattctgatcacaactggaaaattgctcacgtgacactcaacgaagagaag
aaatttcgctatgttttccagggtaccaaaggtgaccctggtaactcagatggcggtatt
taccttgatgacatcactctgacagaaaccccctgccctacaggggtttggaccatccgg
aatatctcccaggtccttgagaacacagtgaaaggggacaggctcgtgagccctaggttc
tacaattccgagggttatggttttggggtgaccttgtaccccaatggtagaatcaccagt
aactctggctacctgggactcgctttccacttgtacagtggggataacgatgtgattctg
gagtggccagtggagaacgagcaggccataatgaccatcctggaccaggaacctgatgcc
aggaacaggatgtccttgagtttgatgttcactacctccaagtaccaaacatcttcagct
ataaatggctctgtcatctgggacaggccaaccaaggttggagtctatgataaggactgt
gattgttttagaagcattgactggggttggggtcaggccatttcccaccagatgctgatg
agaagaaatttccttaaagatgacaccctcatcatcttcgtggactttaaagaccttacc
cacttgaggcagactgaagtccccatttccagcagaagcgtgataccccgaggactcctt
ctgcaaggccaggagcctcttgccttgggagactccagaatagccatgatggaggaatcc
ctgccaagaaggctggaccagagacagcccagcagaccaaagcgctcagtggaaaatact
ggtcccatggaggaccacaactggccacagtacttcagagacccatgtgacccaaaccct
tgccagaatgaaggcacctgtgtgaacgtaaagggaatggccagctgcaggtgcgtctct
gggcatgcctttttctacacaggggagcgctgtcaggctatgcatgtgcacggaagcttg
ctgggcctgctcattggctgcatcactgctttgatcttcttgaccttcatcacattctcc
aacacttaccaaaagctgaggcagtga

DBGET integrated database retrieval system