KEGG   Rattus norvegicus (rat): 25685
Entry
25685             CDS       T01003                                 

Gene name
Igfbp1, IBP1, IGF-BP25, IGFBA
Definition
(RefSeq) insulin-like growth factor binding protein 1
  KO
K23578  insulin-like growth factor-binding protein 1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    25685 (Igfbp1)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Others
   Insulin-like growth factor-binding proteins
    25685 (Igfbp1)
SSDB
Motif
Pfam: Thyroglobulin_1 IGFBP DUF1566
Other DBs
NCBI-GeneID: 25685
NCBI-ProteinID: NP_037276
RGD: 2872
Ensembl: ENSRNOG00000058780
UniProt: P21743
Position
14q21
AA seq 272 aa
MPEFLTVVSWPFLILLSFQVRVVAGAPQPWHCAPCTAERLELCPPVPASCPEISRPAGCG
CCPTCALPLGAACGVATARCAQGLSCRALPGEPRPLHALTRGQGACVLEPAAPATSSLSG
SQHEEAKAAVASEDELAESPEMTEEQLLDSFHLMAPSREDQPILWNAISTYSSMRAREIT
DLKKWKEPCQRELYKVLERLAAAQQKAGDEIYKFYLPNCNKNGFYHSKQCETSLDGEAGL
CWCVYPWSGKKIPGSLETRGDPNCHQYFNVQN
NT seq 819 nt   +upstreamnt  +downstreamnt
atgccggagttcctaactgttgtttcttggccgttcctgatcctcctgtccttccaggtt
cgcgtagtcgctggagccccccagccatggcactgtgctccctgcactgctgagaggctg
gagctctgtccacccgtgcctgcttcgtgccccgagatttctcggcctgcgggctgtggc
tgctgcccgacatgtgccttgccactgggtgctgcctgtggtgtggccactgcgcgctgc
gctcagggactcagctgccgtgcgctgccaggggagcctcgacctctgcatgccctcacc
cgtggccagggagcctgtgtactagaacctgccgcacccgccacgagcagcttgtccggt
tctcagcatgaagaggcaaaggctgctgtggcctctgaggatgagcttgccgagagccca
gagatgacagaggaacagctgctggatagcttccacctcatggccccatcccgtgaggac
cagcccatcctgtggaatgccattagcacctacagcagcatgcgggcccgggagatcact
gacctcaagaaatggaaggagccctgccaacgggaactctataaagtgttagagagatta
gctgccgctcaacagaaagcaggagatgagatctacaaattttatctgccaaactgcaac
aagaatggattttatcacagcaaacagtgcgagacatctctggatggagaagctgggctc
tgctggtgtgtctacccatggagtgggaagaagatccctggatctctggagaccagaggg
gaccccaactgccaccagtattttaatgtgcaaaactga

DBGET integrated database retrieval system