KEGG   Rattus norvegicus (rat): 25688
Entry
25688             CDS       T01003                                 

Gene name
Clcn1, SMCC
Definition
(RefSeq) chloride voltage-gated channel 1
  KO
K05010  chloride channel 1, skeletal muscle
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    25688 (Clcn1)
Ion channels [BR:rno04040]
 Chloride channels
  Chloride channel (CLC)
   25688 (Clcn1)
SSDB
Motif
Pfam: Voltage_CLC CBS
Other DBs
NCBI-GeneID: 25688
NCBI-ProteinID: NP_037279
RGD: 2360
Ensembl: ENSRNOG00000016917
UniProt: P35524
Position
4q24
AA seq 994 aa
MERSQSQQHGGEQSWWGTAPQYQYMPFEHCTSYGLPSENGGLQHRPRKDLGPRHNAHPTQ
IYGHHKEQYSYQAQDRGIPKKTDSSSTVDSLDEDHYSKCQDCVHRLGRVLRRKLGEDWIF
LVLLGLLMALVSWCMDYVSAKSLQAYKWTYAQMQPSLPLQYLAWVTFPLILILFSALFCQ
LISPQAVGSGIPEMKTILRGVVLKEYLTLKAFVAKVVALTAGLGSGIPVGKEGPFVHIAS
ICAAVLSKFMSMFSGVYEQPYYYTDILTVGCAVGVGCCFGTPLGGVLFSIEVTSTYFAVR
NYWRGFFAATFSAFVFRVLAVWNKDAVTITALFRTNFRMDFPFDLKELPAFAVIGICCGF
LGAVFVYLHRQVMLGVRKHKALSQFLAKHRLLYPGIVTFVIASLTFPPGMGQFMAGELMP
REAISTLFDNNTWVKHIGDPKSLGQSAVWIHPQVNVVIIILLFFVMKFWMSIVATTMPIP
CGGFMPVFVLGAAFGRLVGEIMAMLFPEGILFDDIIYKILPGGYAVIGAAALTGAVSHTV
STAVICFELTGQIAHILPMMVAVILANMVAQSLQPSLYDSIIQVKKLPYLPDLGWNQLSK
FTIFVEDIMVRDVKFVSASCTYGELRNLLQTTTVKTLPLVDSKDSMILLGSVERSELQSL
LQRHLCAERRLKAAQDMARKLSELPYNGQAQLAGEWHPGGRPESFAFVDEDEDEDVSRKT
ELPQTPTPPPPPPPPLPPQFPIAPSYPEEPNGPLPSHKQPPEASDSADQRSSIFQRLLHC
LLGKAHSTKKKITQDSTDLVDNMSPEEIEAWEREQLSQPVCFDFCCIDQSPFQLVEQTTL
HKTHTLFSLLGLHLAYVTSMGKLRGVLALEELQKAIKGHTKSGVQLRPPLASFRNTTSIR
KTPGGPPPPAESWNVPEGEDGAPEREVMVPTMPETPVPPPSPEVPSCLAPARVEGELEEL
EMVGNLGPEEDLADILHGPSLRSTDEEDEDELIL
NT seq 2985 nt   +upstreamnt  +downstreamnt
atggagcggtcccagtcccagcaacatggaggtgaacaaagctggtggggcactgccccc
cagtaccagtacatgcccttcgaacattgtaccagctatggactgccctcagagaatggg
ggccttcagcaccggccccgaaaggacctgggtcccaggcacaatgcccacccaacacag
atatatggccatcacaaagaacaatattcatatcaggcacaggacaggggaatacccaag
aagacggactccagttctactgtggacagcttggatgaggaccactattctaaatgtcaa
gactgtgtccatcgcctgggacgtgtgctgagaaggaagctgggggaagactggatcttt
cttgtgctcctgggcctactgatggctcttgtcagctggtgcatggactatgttagcgcc
aagagccttcaggcctacaagtggacctatgcccagatgcagcccagccttcctctacag
tacttggcctgggtcaccttcccacttatcctcatcctcttcagtgccctcttttgccaa
ctcatctctccccaggctgtgggctctggaatccctgagatgaagacaattcttcgtggt
gttgtcttgaaggaatacctcacactcaaggcctttgtagccaaggtggtggccttgaca
gccggtctgggcagtggtatccctgtggggaaagagggtccctttgttcacattgccagc
atctgtgctgctgtcctcagcaaattcatgtccatgttctctggtgtctatgagcagcca
tactattacactgacatcctgacagtgggctgtgccgtgggggtcggttgctgttttgga
acaccacttggaggagtgctgttcagcatcgaggtcacctctacctactttgccgttcgg
aattactggcgaggattctttgcagccaccttcagtgcctttgtgttccgcgtcctggca
gtgtggaacaaggatgctgtcactattactgctctgttcagaactaatttccggatggat
ttcccctttgacctgaaggaactcccagcttttgctgtcattgggatttgctgcgggttc
ttgggagctgtttttgtttatctgcatcgccaagtcatgctcggtgtccgaaagcacaag
gctctcagccagtttcttgctaagcaccgcctgctctatcctggaatcgttacttttgtc
atcgcctcactcacctttccaccaggaatgggtcaattcatggctggagagctgatgccc
cgtgaagctatcagcaccctctttgacaacaacacatgggtaaagcacataggtgatccc
aaaagcttgggccagtcagctgtgtggattcacccccaggtcaacgtggtcatcatcatc
cttctcttcttcgtcatgaagttttggatgtccattgtggccacgactatgcccataccc
tgtggaggcttcatgcctgtttttgtgctaggagctgcctttggaaggctggtaggagag
atcatggccatgctgttccctgagggtatcttatttgatgatatcatctataagatctta
ccagggggctatgcagtgattggagcagcagctttgacaggggctgtctctcacacagtc
tccacagctgtgatttgcttcgaattaactggtcagattgctcacatcctgcccatgatg
gtggctgttatcttggccaacatggtggcccaaagtctgcagccctccctctatgacagc
atcatccaggtcaagaagcttccctatttgccagaccttggttggaaccagctcagcaaa
tttacaatttttgttgaggacatcatggtacgtgacgtgaagtttgtttcagcttcttgt
acatacggggaactaagaaacctactccagaccaccacagtcaagactttaccattggtt
gactccaaagattcaatgatcctgctaggctctgtggaacgctcagaactgcagtccctc
ctgcagcgccacctgtgtgcagagcgaaggttgaaggctgcccaggacatggctcgaaag
ttatcagagctgccctataatggccaggctcagctggctggggagtggcatcctggtggt
cgacctgagtcctttgccttcgtagatgaagatgaagatgaggacgtctcccggaagaca
gagcttccacagactccaactcctcctcctcctccccctcctcctctgcctccccagttt
cctattgctccatcataccctgaagagcctaacgggccactgcccagccacaaacagccc
cctgaagcttcagactctgcagatcaaaggtcctccatcttccagcgcctgctgcactgc
ttactgggcaaagctcactccacaaagaagaaaataacccaggattcaacagatttagtg
gataacatgtcacctgaagagattgaggcctgggagcgggagcagctgagccagcctgtg
tgttttgatttctgctgcattgaccagtctcccttccagctggtggagcagacaactctg
cacaagactcatacactcttctcacttcttggcctccatcttgcctatgtgaccagcatg
gggaagctcagaggtgtcttggcactagaagagctacagaaagctatcaagggccacacc
aaatctggagtgcagcttcgccctccacttgccagcttccggaatacaacttcaattcgg
aagacccctggggggccaccccctcctgcagagagctggaatgtgcctgagggtgaagat
ggagctcctgaaagagaagtcatggttcctaccatgccagagactcctgtcccaccacca
tctccagaggtcccttcctgcctggccccagccagagtggagggtgagctggaggaactg
gagatggtggggaacctagggcctgaggaggacctggctgacatcttgcatggccccagt
ctgcggtccactgatgaggaagatgaggacgagctgatcctgtga

DBGET integrated database retrieval system