KEGG   Rattus norvegicus (rat): 25689Help
Entry
25689             CDS       T01003                                 

Gene name
Htr5a, 5HT5A, MR22
Definition
(RefSeq) 5-hydroxytryptamine receptor 5A
  KO
K04161  5-hydroxytryptamine receptor 5
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04020  Calcium signaling pathway
rno04080  Neuroactive ligand-receptor interaction
rno04726  Serotonergic synapse
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    25689 (Htr5a)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    25689 (Htr5a)
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    25689 (Htr5a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    25689 (Htr5a)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    25689 (Htr5a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srx DUF2208
Motif
Other DBs
NCBI-GeneID: 25689
NCBI-ProteinID: NP_037280
RGD: 2851
Ensembl: ENSRNOG00000007066
UniProt: P35364
Position
4q11
AA seq 357 aa AA seqDB search
MDLPINLTSFSLSTPSTLEPNRSLDTEALRTSQSFLSAFRVLVLTLLGFLAAATFTWNLL
VLATILRVRTFHRVPHNLVASMAISDVLVAVLVMPLSLVHELSGRRWQLGRRLCQLWIAC
DVLCCTASIWNVTAIALDRYWSITRHLEYTLRARKRVSNVMILLTWALSAVISLAPLLFG
WGETYSELSEECQVSREPSYTVFSTVGAFYLPLCVVLFVYWKIYKAAKFRMGSRKTNSVS
PIPEAVEVKDASQHPQMVFTVRHATVTFQTEGDTWREQKEQRAALMVGILIGVFVLCWFP
FFVTELISPLCSWDIPALWKSIFLWLGYSNSFFNPLIYTAFNRSYSSAFKVFFSKQQ
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggatctgcctataaacttgacctccttttctctctctactccctccactttggaacct
aaccgcagcttggacacggaagccctgcgcactagtcagtcttttctctcagctttccga
gtgctagtcctgactttgctgggctttctagctgccgccacgttcacttggaacctgctg
gtgctggccaccatcctcagggtacgcaccttccaccgagtaccacacaacctggtagca
tccatggctatctcggatgtgctagtagctgtgctggttatgcctctgagcctggtacat
gaactgtctgggcgccgctggcagctgggccggcgtctatgccagctgtggattgcgtgt
gacgtcctctgctgtactgccagcatctggaatgtgacagcaatagctttggaccgctac
tggtcaataacgcgccacctggagtacacactccgtgcccgcaagcgtgtctccaacgtg
atgatcctgctcacttgggcactctccgctgtcatctctctggctccgctgctctttggc
tggggagagacttactcggagctcagtgaagaatgccaggtcagtcgcgagccttcctac
accgtgttctccactgtgggcgccttctacctgccgctgtgtgtggtgctctttgtatac
tggaagatttacaaggctgcgaagttccgcatgggctccaggaagaccaacagcgtctcc
cccatacctgaagctgtggaggtgaaggacgcttcacaacatccccagatggtgttcact
gtccgtcacgccaccgtcaccttccagacagaaggggacacgtggagggaacagaaggag
caaagggcagccctcatggtgggcatcctcattggggtgtttgtcctctgctggttcccc
ttctttgttacggagctcatcagtccgctgtgctcctgggatatccctgccctctggaag
agcatcttcctgtggctgggctattccaactccttcttcaacccgctcatctacacggcg
ttcaacaggagctacagcagtgcttttaaggtcttcttctccaagcagcagtga

DBGET integrated database retrieval system